Property Summary

NCBI Gene PubMed Count 54
PubMed Score 83.32
PubTator Score 54.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.600 4.9e-06
osteosarcoma 1.156 1.6e-04
atypical teratoid / rhabdoid tumor 1.800 4.3e-05
sonic hedgehog group medulloblastoma 1.100 2.1e-03
invasive ductal carcinoma -1.063 2.4e-03

Gene RIF (39)

PMID Text
26527057 Data indicate that RNA interference of NFAT isoforms NFATc1, NFATc2, NFATc3 and NFATc4 regulate gene expression differentially in human retinal microvascular endothelial cells (HRMEC).
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25514788 NFAT3 expression plays a role in regulating CXCR4 expression.
25422138 Suggest nuclear NF-AT3 and NF-AT4 participates in atrial structural remodeling, and that PICP and TGF-beta1 levels may be sensitive serum biomarkers to estimate atrial structural remodeling with atrial fibrillation.
24257415 This is the first study to provide evidence of new and differential roles for NFAT3 and SMAD3 in the osteoarthritis process in the regulation of miR-140 transcription
23888774 Expression level of PPP3R1 and GATA4, and NFATC4 genes for transcription factors did not differ in studied subgroups of patients.
22977251 Data indicate that NFATc3 undergoes rapid dephosphorylation and nuclear translocation that are essentially complete within 20 min, although NFATc4 remains phosphorylated and localized to the cytosol.
22593154 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
22378890 Dendritic spine loss and dendritic branching simplification induced by amyloid-beta peptide exposure are mimicked by constitutively active NFATC4, and abolished when NFATC4 activation is blocked by the genetically encoded inhibitor VIVIT.
22234350 Polymorphisms in the NFATc4 gene may confer certain protection or predisposition for new-onset diabetes after transplantation (NODAT).
22164265 Syndecan-4 is essential for development of concentric myocardial hypertrophy via stretch-induced activation of the calcineurin-NFAT pathway
21606195 These data suggest that the opposing transcriptional activities of FoxP1 and Nfat3 maintain cardiomyocyte homeostasis.
21081043 The expression of COX-2 was significantly associated with the expressions of transcription factors NFAT3 and c-Fos in nonsmall cell lung cancer.
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
20101218 an earlier unknown NFAT3/LCN2 axis that critically controls motility in breast cancer
19913121 Observational study of gene-disease association. (HuGE Navigator)
19784808 Data show that inhibition of NFAT3 activation by shNFAT3 significantly downregulated tumor necrosis factor (TNF)-alpha induction, its receptor TNFR1, caspase 10, caspase 3, and poly (ADP-ribose) polymerase.
19653005 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18668201 estrogen receptor may play a critical role in regulation of NFAT3 transcriptional activity
18097055 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
18034994 Data show that the calcineurin pathway is activated in hypertrophic myocardium as demonstrated by increased calcineurin activity and expression of calcineurin A-beta and B, and GATA-4, and a shift of cytoplasmic NFAT-3 into the nucleus.
17875713 Results provided direct evidence for the anti-oncogenic potential of the NFAT3 transcription factor.
17213202 RSK2 is an important kinase for NFAT3 in mediating myotube differentiation
17194453 overexpression of NFAT3 in cell lines originated from kidney decreased dose-dependently both ERalpha and ERbeta transcriptional activities in a ligand-independent manner.
17044076 Neuronal nuclear translocation of NFAT requires a functional cytoskeleton.
16690925 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
16645724 ionizing radiation is able to enhance cyclin D1 transcription induced by B[a]PDE, and NFAT3 is involved in the regulation of cyclin D1 transcription by B[a]PDE or B[a]PDE plus ionizing radiation
16489119 This study demonstrates that silica was able to activate NFAT3 in an oxygen radical-dependent manner, which was required for TNF-alpha induction.
16260021 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
16219765 NFAT3 may play a role in estrogen receptor signaling in breast cancer cells
12939651 Observational study of gene-disease association. (HuGE Navigator)
12939651 Polymorphism of the NFATC4 gene plays a role in the development of human cardiac hypertrophy.
12788643 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
12482669 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
8814265 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
7999066 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
7957556 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef

AA Sequence

MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIGIPRPPPPRPG      1 - 70
MHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITSISPTPEPPAALEDNPDAWGD     71 - 140
GSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWSFFSDASDEAALYAACDEVESELNEAASRFG    141 - 210
LGSPLPSPRASPRPWTPEDPWSLYGPSPGGRGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSA    211 - 280
SPALSRRGSLGEEGSEPPPPPPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASC    281 - 350
NGKLPLGAEESVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR    351 - 420
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHAFYQVHRITGK    421 - 490
MVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGETDIGRKNTRVRLVFRVHVPQ    491 - 560
GGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRGGEELVLTGSNFLPDSKVVFIERGPDGKLQW    561 - 630
EEEATVNRLQSNEVTLTLTVPEYSNKRVSRPVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRG    631 - 700
FPSASATPFGTDMDFSPPRPPYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRG    701 - 770
TTGCAQPPAVSFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGY    771 - 840
NKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPPA            841 - 902
//

Text Mined References (60)

PMID Year Title
26527057 2015 NFAT isoforms play distinct roles in TNF?-induced retinal leukostasis.
25514788 2014 Novel role for NFAT3 in ERK-mediated regulation of CXCR4.
25422138 2014 Increased expression of NF-AT3 and NF-AT4 in the atria correlates with procollagen I carboxyl terminal peptide and TGF-?1 levels in serum of patients with atrial fibrillation.
24302958 2013 Molecular profiling of acute and chronic rejections of renal allografts.
24257415 2013 NFAT3 and TGF-?/SMAD3 regulate the expression of miR-140 in osteoarthritis.
23888774 [Expression profile of calcineurin pathway genes in myocardium tissues in relation to ischemic heart remodeling in humans].
23703530 2013 Distinct and additive effects of sodium bicarbonate and continuous mild heat stress on fiber type shift via calcineurin/NFAT pathway in human skeletal myoblasts.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23543060 2013 MicroRNA-26 governs profibrillatory inward-rectifier potassium current changes in atrial fibrillation.
22977251 2012 Distinct activation properties of the nuclear factor of activated T-cells (NFAT) isoforms NFATc3 and NFATc4 in neurons.
22378890 2012 Inhibition of the NFAT pathway alleviates amyloid ? neurotoxicity in a mouse model of Alzheimer's disease.
22234350 2012 Genetic polymorphisms of the transcription factor NFATc4 and development of new-onset diabetes after transplantation in Hispanic kidney transplant recipients.
22164265 2011 Syndecan-4 is essential for development of concentric myocardial hypertrophy via stretch-induced activation of the calcineurin-NFAT pathway.
21606195 2011 Opposing roles of FoxP1 and Nfat3 in transcriptional control of cardiomyocyte hypertrophy.
21081043 2010 [Expression and significance of COX-2 and its transcription factors NFAT3 and c-Jun in non-small cell lung cancer].
21047202 2010 Using genetic and clinical factors to predict tacrolimus dose in renal transplant recipients.
20881960 2010 Hundreds of variants clustered in genomic loci and biological pathways affect human height.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20101218 2010 NFAT3 transcription factor inhibits breast cancer cell motility by targeting the Lipocalin 2 gene.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19784808 2009 Doxorubicin-mediated apoptosis in glioma cells requires NFAT3.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19653005 2009 The combined impact of metabolic gene polymorphisms on elite endurance athlete status and related phenotypes.
19026640 2008 Regulation of the stability and transcriptional activity of NFATc4 by ubiquitination.
18691762 2008 The interleukin-1 receptor associated kinase 1 contributes to the regulation of NFAT.
18675896 2008 Alternative splicing and expression of human and mouse NFAT genes.
18668201 2008 Repression of NFAT3 transcriptional activity by estrogen receptors.
18347059 2008 Integration of protein kinases mTOR and extracellular signal-regulated kinase 5 in regulating nucleocytoplasmic localization of NFATc4.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18034994 Activation of the calcineurin/NFAT signalling cascade starts early in human hypertrophic myocardium.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17875713 2007 Nuclear factor of activated T3 is a negative regulator of Ras-JNK1/2-AP-1 induced cell transformation.
17213202 2007 RSK2 mediates muscle cell differentiation through regulation of NFAT3.
17194453 2007 Tissue type-specific modulation of ER transcriptional activity by NFAT3.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17044076 2007 Zinc and the cytoskeleton in the neuronal modulation of transcription factor NFAT.
16645724 2006 Involvement of nuclear factor of activated T cells 3 (NFAT3) in cyclin D1 induction by B[a]PDE or B[a]PDE and ionizing radiation in mouse epidermal Cl 41 cells.
16489119 2006 Essential role of ROS-mediated NFAT activation in TNF-alpha induction by crystalline silica exposure.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16219765 2005 Stimulatory cross-talk between NFAT3 and estrogen receptor in breast cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12939651 2003 Polymorphisms of genes of the cardiac calcineurin pathway and cardiac hypertrophy.
12788643 2003 Regulation of T cell activation by HIV-1 accessory proteins: Vpr acts via distinct mechanisms to cooperate with Nef in NFAT-directed gene expression and to promote transactivation by CREB.
12787506 2003 Neurotrophins and netrins require calcineurin/NFAT signaling to stimulate outgrowth of embryonic axons.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12370307 2002 Targeted disruption of NFATc3, but not NFATc4, reveals an intrinsic defect in calcineurin-mediated cardiac hypertrophic growth.
11997522 2002 Phosphorylation of NFATc4 by p38 mitogen-activated protein kinases.
11877454 2002 NFAT: ubiquitous regulator of cell differentiation and adaptation.
11514544 2001 Requirement of two NFATc4 transactivation domains for CBP potentiation.
11439183 2001 Signals transduced by Ca(2+)/calcineurin and NFATc3/c4 pattern the developing vasculature.
10611249 2000 Integration of calcium and cyclic AMP signaling pathways by 14-3-3.
10089876 1999 Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT.
9660947 1998 Selective inhibition of NFAT activation by a peptide spanning the calcineurin targeting site of NFAT.
9568714 1998 A calcineurin-dependent transcriptional pathway for cardiac hypertrophy.
9143705 1997 Transcription factors of the NFAT family: regulation and function.
7999066 1994 Human immunodeficiency virus type-1 tat enhances interleukin-2 promoter activity through synergism with phorbol ester and calcium-mediated activation of the NF-AT cis-regulatory motif.
7749981 1995 Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins.