Property Summary

NCBI Gene PubMed Count 48
PubMed Score 101.32
PubTator Score 55.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

 GWAS Trait (1)

Protein-protein Interaction (5)

Gene RIF (33)

PMID Text
26527057 Data indicate that RNA interference of NFAT isoforms NFATc1, NFATc2, NFATc3 and NFATc4 regulate gene expression differentially in human retinal microvascular endothelial cells (HRMEC).
26374065 two NFAT isoforms (NFAT4 and NFAT1) have shifted band-pass windows for the same receptor in the GPCR signaling pathway
25818645 Results show that two protein isoforms NFAT1 and NFAT4 are both cytosolic and stimulated by the same Ca2+ messenger but require distinct subcellular Ca2+ signals for activity.
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25422138 Suggest nuclear NF-AT3 and NF-AT4 participates in atrial structural remodeling, and that PICP and TGF-beta1 levels may be sensitive serum biomarkers to estimate atrial structural remodeling with atrial fibrillation.
25215946 NFATc3 interacted in a SUMO-dependent manner with Trim17, an E3 ubiquitin ligase necessary for neuronal apoptosis
24582564 Microvesicles from tumor cells transferred TrpC5 to endothelial cells, inducing the expression of P-glycoprotein by activation of the transcription factor NFATc3 (nuclear factor of activated T cells isoform c3).
23929433 AP-1 and NFAT4 complex promotes miR-23a expression.
23219532 The closely related transcription factors NFAT1 and NFAT4 possess distinct nuclear localization dynamics in response to cell stimulation.
22977251 Data indicate that NFATc3 undergoes rapid dephosphorylation and nuclear translocation that are essentially complete within 20 min, although NFATc4 remains phosphorylated and localized to the cytosol.
22846573 Abeta-activated NFAT4 proteins were associated with astrocytic BACE1 gene expression via direct interaction with the BACE1 promoter region.
22749879 The authors report that NFAT4 and NF-kappaB interact at the KB element to co-operatively activate both human polyomavirus JC early and late transcription and viral DNA replication.
22593154 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
21642596 NFATc3 is specifically required for IL2 and cyclooxygenase-2 (COX2) gene expression in T cells and for T-cell proliferation and NFATc3 regulates COX2 in endothelial cells
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18815128 CHP2 has a role in tumorigenesis and as an activator of the calcineurin/NFAT signaling pathway
18676376 NFAT and MyoD cooperation regulates myogenin expression and myogenesis
18097055 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
17035332 Calcium signaling and the activation of NFAT in glial cells are required for JC Virus infection of the CNS.
16690925 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
16445977 We found that [Ca(2+)](i) oscillations were associated with NFAT translocation into the nucleus in undifferentiated hMSCs. As the hMSCs differentiated to adipocytes, the [Ca(2+)](i) oscillations disappeared and the translocation of NFAT ceased.
16260608 NFATc3 is negatively regulated by class II histone deacetylases through the DnaJ (heat shock protein-40) superfamily member Mrj
16260021 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
15173172 NFAT and thyroid transcription factor-1 have roles in regulating transcription of the surfactant protein D gene
12788643 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
12482669 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
11997392 transactivation activity and role in inducing differentiation of CD4(+)CD8(+) T cells
8814265 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
7999066 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
7957556 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef

AA Sequence

MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPLCLPHHGLPSH      1 - 70
SSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNCHQELDAHEDDLQINDPEREF     71 - 140
LERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDASSCESLSHIYDDVDSELNEAAARFTLGSPLT    141 - 210
SPGGSPGGCPGEETWHQQYGLGHSLSPRQSPCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAE    211 - 280
VCYAGSLSPHHSPVPSPGHSPRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAI    281 - 350
LPGKLELCSDDQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL    351 - 420
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQMFIGTADDRYL    421 - 490
RPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGILKLRNSDIELRKGETDIGRK    491 - 560
NTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELPHIEKYSINSCSVNGGHEMVVTGSNFLPESK    561 - 630
IIFLEKGQDGRPQWEVEGKIIREKCQGAHIVLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPV    631 - 700
LMKQEHREEIDLSSVPSLPVPHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCR    701 - 770
DESVSKEQHMIPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG    771 - 840
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVADQITGQPSSQL    841 - 910
QPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTASSPSPATRMHSGQHSTQAQS    911 - 980
TGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDREPNFATIGLQDITLDDVNEIIGRDMSQISVS    981 - 1050
QGAGVSRQAPLPSPESLDLGRSDGL                                                1051 - 1075
//

Text Mined References (49)

PMID Year Title
26527057 2015 NFAT isoforms play distinct roles in TNF?-induced retinal leukostasis.
26374065 2015 Band-pass processing in a GPCR signaling pathway selects for NFAT transcription factor activation.
25818645 2015 Distinct spatial Ca2+ signatures selectively activate different NFAT transcription factor isoforms.
25422138 2014 Increased expression of NF-AT3 and NF-AT4 in the atria correlates with procollagen I carboxyl terminal peptide and TGF-?1 levels in serum of patients with atrial fibrillation.
25215946 2015 Control of neuronal apoptosis by reciprocal regulation of NFATc3 and Trim17.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24582564 2014 Tumor endothelial expression of P-glycoprotein upon microvesicular transfer of TrpC5 derived from adriamycin-resistant breast cancer cells.
24330068 2014 Nuclear Raf-1 kinase regulates the CXCR5 promoter by associating with NFATc3 to drive retinoic acid-induced leukemic cell differentiation.
23929433 2014 miR-23a inhibits E-cadherin expression and is regulated by AP-1 and NFAT4 complex during Fas-induced EMT in gastrointestinal cancer.
23543060 2013 MicroRNA-26 governs profibrillatory inward-rectifier potassium current changes in atrial fibrillation.
23219532 2013 Dynamic response diversity of NFAT isoforms in individual living cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22977251 2012 Distinct activation properties of the nuclear factor of activated T-cells (NFAT) isoforms NFATc3 and NFATc4 in neurons.
22846573 2012 A?-induced Ca(2+) influx regulates astrocytic BACE1 expression via calcineurin/NFAT4 signals.
22749879 2012 Cooperative roles of NF-?B and NFAT4 in polyomavirus JC regulation at the KB control element.
21642596 2011 NFATc3 regulates the transcription of genes involved in T-cell activation and angiogenesis.
21047202 2010 Using genetic and clinical factors to predict tacrolimus dose in renal transplant recipients.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18815128 2008 CHP2 activates the calcineurin/nuclear factor of activated T cells signaling pathway and enhances the oncogenic potential of HEK293 cells.
18676376 2008 Cooperative synergy between NFAT and MyoD regulates myogenin expression and myogenesis.
18675896 2008 Alternative splicing and expression of human and mouse NFAT genes.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17035332 2006 NFAT4 is required for JC virus infection of glial cells.
16445977 2006 ATP autocrine/paracrine signaling induces calcium oscillations and NFAT activation in human mesenchymal stem cells.
16260608 2005 The DnaJ-related factor Mrj interacts with nuclear factor of activated T cells c3 and mediates transcriptional repression through class II histone deacetylase recruitment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15173172 2004 Nuclear factor of activated T cells regulates transcription of the surfactant protein D gene (Sftpd) via direct interaction with thyroid transcription factor-1 in lung epithelial cells.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12788643 2003 Regulation of T cell activation by HIV-1 accessory proteins: Vpr acts via distinct mechanisms to cooperate with Nef in NFAT-directed gene expression and to promote transactivation by CREB.
12671993 2003 NFAT4 is expressed in primary astrocytes and activated by glutamate.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12417987 2002 A missense mutation (R565W) in cirhin (FLJ14728) in North American Indian childhood cirrhosis.
12370307 2002 Targeted disruption of NFATc3, but not NFATc4, reveals an intrinsic defect in calcineurin-mediated cardiac hypertrophic growth.
11877454 2002 NFAT: ubiquitous regulator of cell differentiation and adaptation.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.
10089876 1999 Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT.
9759864 1998 Carboxyl-terminal 15-amino acid sequence of NFATx1 is possibly created by tissue-specific splicing and is essential for transactivation activity in T cells.
9660947 1998 Selective inhibition of NFAT activation by a peptide spanning the calcineurin targeting site of NFAT.
9630228 1998 Intramolecular masking of nuclear import signal on NF-AT4 by casein kinase I and MEKK1.
9498773 1998 Distinct NFAT family proteins are involved in the nuclear NFAT-DNA binding complexes from human thymocyte subsets.
9374467 1997 Nuclear accumulation of NFAT4 opposed by the JNK signal transduction pathway.
9143705 1997 Transcription factors of the NFAT family: regulation and function.
9121455 1997 Control of NFATx1 nuclear translocation by a calcineurin-regulated inhibitory domain.
7999066 1994 Human immunodeficiency virus type-1 tat enhances interleukin-2 promoter activity through synergism with phorbol ester and calcium-mediated activation of the NF-AT cis-regulatory motif.
7749981 1995 Isolation of two new members of the NF-AT gene family and functional characterization of the NF-AT proteins.
7739550 1995 NFATx, a novel member of the nuclear factor of activated T cells family that is expressed predominantly in the thymus.