Property Summary

NCBI Gene PubMed Count 9
PubMed Score 24.95
PubTator Score 13.85

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
oligodendroglioma 1.300 7.0e-03
psoriasis -1.600 1.2e-04
osteosarcoma -1.626 2.0e-04
astrocytoma 1.200 6.3e-03
medulloblastoma, large-cell -1.100 2.4e-03
juvenile dermatomyositis 1.154 1.0e-09
acute quadriplegic myopathy 1.065 8.9e-06
pancreatic ductal adenocarcinoma liver m... 1.544 4.2e-03
intraductal papillary-mucinous carcinoma... 1.200 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.500 3.9e-03
aldosterone-producing adenoma -1.024 1.9e-02
Breast cancer 1.400 1.6e-20
ovarian cancer -2.100 2.9e-09

Gene RIF (1)

PMID Text
20410506 ZBTB25 functions as a negative regulator of nuclear factor of activated T cells (NF-AT) activation, such that RNA interference mediated knockdown resulted in enhanced activation of target genes.

AA Sequence

MAEPVGKRGRWSGGSGAGRGGRGGWGGRGRRPRAQRSPSRGTLDVVSVDLVTDSDEEILEVATARGAADE      1 - 70
VEVEPPEPPGPVASRDNSNSDSEGEDRRPAGPPREPVRRRRRLVLDPGEAPLVPVYSGKVKSSLRLIPDD     71 - 140
LSLLKLYPPGDEEEAELADSSGLYHEGSPSPGSPWKTKLRTKDKEEKKKTEFLDLDNSPLSPPSPRTKSR    141 - 210
THTRALKKLSEVNKRLQDLRSCLSPKPPQGQEQQGQEDEVVLVEGPTLPETPRLFPLKIRCRADLVRLPL    211 - 280
RMSEPLQSVVDHMATHLGVSPSRILLLFGETELSPTATPRTLKLGVADIIDCVVLTSSPEATETSQQLQL    281 - 350
RVQGKEKHQTLEVSLSRDSPLKTLMSHYEEAMGLSGRKLSFFFDGTKLSGRELPADLGMESGDLIEVWG     351 - 419
//

Text Mined References (15)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20410506 2010 Gene enrichment profiles reveal T-cell development, differentiation, and lineage-specific transcription factors including ZBTB25 as a novel NF-AT repressor.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
15698469 2005 Proteins with two SUMO-like domains in chromatin-associated complexes: the RENi (Rad60-Esc2-NIP45) family.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8943202 1996 NF-AT-Driven interleukin-4 transcription potentiated by NIP45.