Property Summary

NCBI Gene PubMed Count 173
PubMed Score 259.36
PubTator Score 189.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Hypertension, Pulmonary 37 0.0 0.0
Nervous System Diseases 53 0.0 0.0
Disease Target Count
nervous system disorder 53
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Kidney cancer 2613 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 3.435 1.7

Expression

  Differential Expression (8)

Disease log2 FC p
Breast cancer -1.800 2.9e-22
ependymoma 1.300 2.6e-05
group 3 medulloblastoma -1.100 3.7e-02
interstitial cystitis 1.200 1.4e-03
non-small cell lung cancer -1.063 1.9e-08
osteosarcoma -2.559 1.9e-04
subependymal giant cell astrocytoma 2.121 1.9e-03
ulcerative colitis 1.300 3.5e-03

Gene RIF (133)

AA Sequence

MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLK      1 - 70
PYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP     71 - 140
PLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPA    141 - 210
HYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPS    211 - 280
SHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVE    281 - 350
FLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH    351 - 420
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYE    421 - 490
KIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL    491 - 560
QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDK    561 - 630
DKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHG    631 - 700
GLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPAL    701 - 770
MAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG    771 - 840
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE    841 - 910
IIRKEFSGPPARNQT                                                           911 - 925
//

Text Mined References (180)

PMID Year Title