Property Summary

NCBI Gene PubMed Count 162
PubMed Score 241.57
PubTator Score 189.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma -2.559 1.9e-04
posterior fossa group B ependymoma 2.100 4.6e-08
non-small cell lung cancer -1.063 1.9e-08
interstitial cystitis 1.400 3.2e-04
group 4 medulloblastoma -1.200 5.7e-03
subependymal giant cell astrocytoma 2.121 1.9e-03
Breast cancer -2.300 7.8e-17
ulcerative colitis 1.300 3.5e-03

Protein-protein Interaction (4)

Gene RIF (124)

PMID Text
26903518 Up-regulation of Store-operated Ca2+ Entry and Nuclear Factor of Activated T Cells Promote the Acinar Phenotype of the Primary Human Salivary Gland Cells.
26527057 Data indicate that RNA interference of NFAT isoforms NFATc1, NFATc2, NFATc3 and NFATc4 regulate gene expression differentially in human retinal microvascular endothelial cells (HRMEC).
26374065 two NFAT isoforms (NFAT4 and NFAT1) have shifted band-pass windows for the same receptor in the GPCR signaling pathway
26238508 These data suggest that NFATc2 expression is regulated by intracellular calcium and in vitro stretch, and that the stretch response in human myometrial cells is dependent upon intracellular calcium signalling pathways.
25987655 In multivariate logistic regression, the intronic rs6021191 variant in nuclear factor of activated T cells 2 (NFATC2) had the strongest association with hypersensitivity to asparaginase.
25818645 Results show that two protein isoforms NFAT1 and NFAT4 are both cytosolic and stimulated by the same Ca2+ messenger but require distinct subcellular Ca2+ signals for activity.
25797200 inhibits CCR7 expression during the course of dendritic cell maturation
25735562 NFAT1-mediated IL8 production promotes the migration of primary human neutrophils in vitro and also promotes neutrophil infiltration in tumor xenografts
25728138 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
25376468 no significant correlation of genetic polymorphisms with disease activity in rheumatoid arthritis patients in Poland
24931237 NFAT-1, STAT-1 and AP-1 might be the central transcription factors in the pathogenesis of pre-eclampsia.
24561192 USP22 deubiquitinates and stabilizes NFATc2 protein levels thereby promoting IL2 expression.
24551078 NFATc2 exhibited a higher relative affinity for binding site DS3 as compared with members of the C/EBP family (C/EBP alpha and beta).
24486774 Data suggest involvement of SALL4 (sal-like 4) and NFATC2(nuclear factor of activated T-cells, cytoplasmic, calcineurin-dependent 2 ) genes disruption in cardiac and skeletal anomalies.
24477908 Using a human CTL system model based on a CD8(+)/CD103(-) T cell clone specific of a lung tumor-associated Ag, we demonstrated that the transcription factors Smad2/3 and NFAT-1 are two critical regulators of this process.
24187576 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
24173147 NFAT1 is differentially expressed in stimulated CD4-positive vs CD8-positive T cells.
24136923 Translocation of NFAT1 to the cell nucleus is a direct, sensitive, reproducible and quantitative pharmacodynamic readout for tacrolimus action.
24106272 in vivo biochemical or genetic inhibition of NFATc2 activity in megakaryocyte diminishes platelet CD40L implicates the NFATc2/EGR-1 axis as a key regulatory pathway of inflammatory and immunomodulatory activity in platelets
23762456 Overexpressed NFAT1 in glioblastoma multiforme cells was mainly located in the nucleus, where it acted as a transcription factor.
23665382 Data suggest a model in which IL-2 transcriptional synergy is mediated by the unique recruitment of a cJun homodimer to the -45 NFAT site by NFATc2, where it acts as a co-activator for IL-2 transcription.
23359789 Both WNT5A and NFATc2 proteins are highly expressed in human pancreatic cancer tissues.
23227982 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
23060442 Endorepellin affects angiogenesis by antagonizing diverse VEGFR2-evoked signaling pathways: transcriptional repression of hypoxia-inducible factor 1alpha and VEGFA and concurrent inhibition of NFAT1 activation.
22986745 Data elucidate a previously unidentified mechanism by which galectin-3 regulates autotaxin and assign a novel role for NFAT1 during melanoma progression.
22911897 haplo-insufficiency of NFATC2 cooperates with activation of the JAK-STAT signaling pathway in the pathogenesis of JAK2V617F-positive ET with del(20q).
22787160 Transcription factor NFAT1 activates the mdm2 oncogene independent of p53.
22767506 LCN2 and TWEAKR-TWEAK as crucial downstream effectors of NFAT1 that regulate breast cancer cell motility and invasive capacity.
22718120 Here we show that the calcineurin/nuclear factor of activated T cells c2 (NFATc2) pathway has an antiapoptotic role in melanoma cells.
22699055 Transfection with HCV C gene up-regulates NFAT1 expression and promotes the cell cycle progression and proliferation of intrahepatic cholangiocarcinoma cells.
22627363 NFAT1 and NFAT2 facilitated IL-17A expression in human T cells, though distinct mechanisms might be involved in these effects
22593154 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
22422068 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
22363514 The present study investigated the effect of heart failure aetiology on Ca(+2) handling proteins and NFAT1, MEF2C and GATA4 (transcription factors) in the same cardiac tissue.
22333584 NFAT1 directly binds to distal sites in the c-Myc promoter with different affinities.
22116621 Inhibition of NFAT or targeting of NFATc3 with small interfering RNA (siRNA) lowers the AIF-1/IRT-1 ratio and favours an anti-proliferative outcome for atherosclerosis.
22077140 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
22045870 calcium responsiveness of IL-31 promoter required NFAT binding sites that bind NFATc1 and NFATc2 in vitro and in vivo.
21964595 a novel negative cross talk between the NFAT1- and Stat5-signaling cascades that may affect breast tumor formation, growth, and metastasis
21803625 The binding of NFAT1 to the NKX2-3 promoter region with rs1190140 was confirmed by chromatin immunoprecipitation assay.
21799768 the prolonged IL-4 expression in NFAT1 deficient Th2 cells is mediated by preferential binding of JUNB/SATB1 to the IL-4 promoter with permissive chromatin architecture
21628454 a critical role of the GSK-3beta-HDM2 signaling loop in the regulation of NFATc2 protein stability and growth promotion
21576369 Data demonstrate that IRF-2BP2 is a negative regulator of the NFAT1 transcription factor and suggest that NFAT1 repression occurs at the transcriptional level.
21325277 Kinetic analyses of each step linking Ca2+ release-activated Ca2+ channel activation to NFAT1 nuclear residency reveals that the rate-limiting step is transcription factor exit from the nucleus
21282105 minocycline selectively impairs NFAT-mediated transcriptional activation, a result of increased phosphorylation and reduced nuclear translocation of the isoform NFAT1
21176845 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
21047202 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20834230 Data show that NFATc2 inhibits polyQ aggregation in cells and is required for HSF1-mediated suppression of aggregation, and that HSF1 and NFATc2 cooperatively induce expression of PDZK3 and alphaB-crystallin, which facilitate degradation of polyQ.
20677014 Statistical analysis indicated that six genes, NFATC2, SCP2, CACNA1C, TCRA, POLE, and FAM3D, were associated with narcolepsy.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20628086 Genetic variation at the NFATC2 locus contributes to edema among individuals who receive rosiglitazone.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20609354 High Wnt/Ca2+/NFAT signaling maintains survival of Ph+ leukemia cells upon inhibition of Bcr-Abl.
20557936 A region of NFATc2 C-terminal of the DNA binding domain was necessary and sufficient for interaction with cJun in the absence of DNA, and this same region of NFATc2 was required for the synergistic activation of IL-2 transcription in T cells.
20448330 essential for the expression of a glioblastoma multiforme related IL-13Ra2 transcript
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379146 Observational study and genome-wide association study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20368097 GATA3-NFAT1 complex may play an important role in the regulation of IL-13 transcription in human T cells.GATA3-NFAT1 complex may play an important role in the regulation of IL-13 transcription in human T cells.
20367554 BAI2 is a functional GPCR regulated by proteolytic processing and activates the NFAT pathway
20237496 Observational study of gene-disease association. (HuGE Navigator)
20219685 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20139419 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
20097868 Data demonstrate that NFAT1 mediates PlGF-induced myelomonocytic cell recruitment via the induction of TNF-alpha.
20093726 the the calcineurin/NFAT pathway has a role in lymphoma/leukemogenesis [review]
19913121 Observational study of gene-disease association. (HuGE Navigator)
19900447 Serum promotes pancreatic cancer growth through induction of the proproliferative NFAT/c-Myc axis.
19843528 the direct involvement of NFAT1 in the transcriptional regulation of hTERT.
19833725 3BP2 induces the protein complex with cellular signaling molecules through phosphorylation of Tyr(183) and SH2 domain leading to the activation of NFAT in B cells
19458075 SFRP2 is a novel stimulator of angiogenesis that stimulates angiogenesis via a calcineurin/NFAT pathway and may be a favorable target for the inhibition of angiogenesis in solid tumors.
19318584 The extent of central tumor necrosis was decreased in the tumors in NFATc2((-/-)) mice, and this finding was associated with reduced tumor necrosis factor-alpha and interleukin-2 (IL-2) production by CD8(+) T cells.
19318479 A new translocation involving EWSRI and NFATc2 was cloned from Ewing sarcoma patients.
19286996 Endogenous expression of miR-184 in cord blood is 58.4-fold higher compared with adult blood CD4+ T cells, and miR-184 blocks production of NFAT1 protein through its complementary target sequence on the NFATc2 mRNA without transcript degradation.
19192391 Lck regulated the activity of PKD2 by tyrosine phosphorylation, which in turn may have modulated the physiological functions of PKD2 during T cell receptor-induced T cell activation.
18973208 Children with type 1 diabetes show decreased insudtion of MFATc2 in T cells.
18962896 our results establish crucial roles for enhancer element CNS-9, and NFAT1 and IRF4 that bind to it, for IL-10 expression in differential T helper subsets.
18931684 Normalization of the constitutive VEGFR2 signaling in hemangioma endothelial cells with soluble VEGFR1 or antibodies that neutralize VEGF or stimulate beta1 integrin
18710929 NFATc2 has a role in colitis by controlling mucosal T cell activation in an IL-6-dependent manner
18676376 NFAT and MyoD cooperation regulates myogenin expression and myogenesis
18641302 accumulation of HIF-1alpha in activated mast cells requires up-regulation of HIF1A gene transcription and depends on the calcineurin-NFAT signaling pathway
18246125 Unexpected coupling of PML with NFAT reveals a novel mechanism underlying the diverse physiological functions of promyelocytic leukemia.
18218901 study found that Homer2 and Homer3 are negative regulators of T cell activation; this is achieved through binding of nuclear factor of activated T cells (NFAT) and by competing with calcineurin
18097055 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
18097033 The promoter/enhancer activity of the NFAT-binding site in the TNF-alpha gene was up-regulated by NFATc2 but not by NFATc1, whereas both NFATs associated similarly with this region.
17882263 O-GlcNAc modification might be required for nuclear translocation of the transcription factors NFkappaB and NFAT
17785820 NFAT1 is a critical regulator of CTLA-4 gene expression that binds to the CTLA-4 promoter in human T cells.
17711847 the WIP-WASP complex plays an important role in WASP stabilization and NFAT activation
17588603 Changes in AP-1 composition and the level of participating NFAT proteins can differentially influence cytokine gene expression, resulting in biological consequences for the modulation and dynamics of the immune response.
17584983 NFAT1 mediates proinflammatory gene expression in response to mechanotransduction
17463169 NFAT1 could explain low FOXP3 expression and diminished Treg frequency in aplastic anemia.
17398070 MAP3K8 and PRKCZ cooperate in the regulation of the transcriptional activity of NFATC2 through the phosphorylation of its amino-terminal domain.
17237447 the amount of NF-ATc2 bound to the promoters of CD154 (CD40L) and IL-2 genes in SLE; although high NF-ATc2 levels translated into higher CD154 transcription in SLE, IL-2 transcription was decreased
17237388 Ral is activated upon BCR stimulation and mediates BCR-controlled activation of AP-1 and NFAT transcription factors.
17082665 In Wiskott-Aldrich CD8+ T cells, a block in cytokine production correlates with reduced nuclear levels of both NFAT-1 and NFAT-2.
16888000 Constitutive expression of NFAT1/NFATc2 in transgenic mice controls bone resorption in vivo by stimulating differentiation and functioning of osteoclasts but not their survival.
16849457 Studies with NFAT1-sufficient and -deficient double-transgenic bone marrow chimeric mice demonstrate that the transcription factor NFAT1 is involved in B cell anergy.
16690925 results indicate that HIV-1 Tat interacts with NFAT, affecting its cooperation with AP-1, without altering independent binding of these transcription factors to DNA
16690925 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
16505480 NFAT promotes breast cancer cell invasion through the induction of COX-2 and the synthesis of prostaglandins
16497967 NFKB and NFAT regulate BLyS expression via at least one NFKB and 2 NFAT BLYS promoter binding sites. Constitutive activation of NFKB and BLyS in NHL-B cells forms a positive feedback loop associated with lymphoma cell survival and proliferation
16455648 NFATc2 activity is regulated by caspase-3
16260021 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
15897878 alpha6beta4 integrin potentiates autotaxin expression through the upregulation and activation of NFAT1.
15857835 NFAT and SRF may interact to cooperatively regulate smooth muscle cell-specific gene expression and NFAT may have a role in the phenotypic maintenance of smooth muscle
15668245 CAML is an important signal transducer for the actions of Ang II in regulating the calcineurin-NFAT pathway and the interaction of CAML with ATRAP may mediate the Ang II actions in vascular physiology
15632146 Expression of NFATc1 and NFATc2 wild type protein or the active catalytic subunit of calcineurin transactivates COX-2 promoter activity, whereas a dominant negative mutant of NFAT inhibited COX-2 induction in colon carcinoma cell lines.
15471864 the nuclear factor of activated T cell-dependent transactivation pathway has a role in viral protein A238L inhibition of cyclooxygenase-2 expression
15347678 Interleukin (IL)-15 and IL-2 reciprocally regulate expression of the chemokine receptor CX3CR1 through selective NFAT1- and NFAT2-dependent mechanisms
15292278 These results suggest a novel and unexpected role for members of the NFAT transcription factor family in the hematopoietic system.
15271374 role in activating interleukin-5 receptor
15184502 Nuclear factor of activated T cells balances angiogenesis activation and inhibition.
15121840 identify a conserved docking site for casein kinase 1 (CK1) in NFAT proteins and show that mutation of this site disrupts NFAT1-CK1 interaction and causes constitutive nuclear localization of NFAT1
15117942 sumoylation has a dual role in the nuclear localization and transcriptional activation of NFAT1
14657699 Differential responsiveness of cord blood T cells cannot be attributed to differences at the level of NFAT1 expression.
12788643 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
12594826 NF-ATc2 induces apoptosis in Burkitt's lymphoma cells through signaling via the B cell antigen receptor
12482669 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
11911478 C-terminal one third of DNA binding domain confers different binding specificity of NFATc and NFATp to an NFAT site in the TNF-alpha promoters
11231878 Recombinant NFATp binds DNA on its own and cooperatively with AP-1 proteins, activates transcription in vitro, is phosphorylated, can be dephosphorylated by calcineurin, and exhibits regulated association with nuclei in vitro.
10207088 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
9845362 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
8834464 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
8814265 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
7999066 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef
7957556 HIV-1 Vpu downregulates NRON levels but HIV-1 Nef upregulates NRON levels in Jurkat cells, leading to reciprocal regulation in NFAT activity through NRON by Vpu and Nef

AA Sequence

MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAYPDDVLDYGLK      1 - 70
PYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHELIQAVGPLRMRDAGLLVEQP     71 - 140
PLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFISDTFSPYTSPCVSPNNGGPDDLCPQFQNIPA    141 - 210
HYSPRTSPIMSPRTSLAEDSCLGRHSPVPRPASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPS    211 - 280
SHVAPQDHGSPAGYPPVAGSAVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVE    281 - 350
FLGPCEQGERRNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH    351 - 420
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVTTTSYE    421 - 490
KIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLVFRVHIPESSGRIVSL    491 - 560
QTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTGQNFTSESKVVFTEKTTDGQQIWEMEATVDK    561 - 630
DKSQPNMLFVEIPEYRNKHIRTPVKVNFYVINGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHG    631 - 700
GLGSQPYYPQHPMVAESPSCLVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPAL    701 - 770
MAAPLSLADAHRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG    771 - 840
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYLDDVNE    841 - 910
IIRKEFSGPPARNQT                                                           911 - 925
//

Text Mined References (169)

PMID Year Title
26903518 2016 Up-regulation of Store-operated Ca2+ Entry and Nuclear Factor of Activated T Cells Promote the Acinar Phenotype of the Primary Human Salivary Gland Cells.
26766444 2016 Endothelial RSPO3 Controls Vascular Stability and Pruning through Non-canonical WNT/Ca(2+)/NFAT Signaling.
26527057 2015 NFAT isoforms play distinct roles in TNF?-induced retinal leukostasis.
26374065 2015 Band-pass processing in a GPCR signaling pathway selects for NFAT transcription factor activation.
26238508 2015 Nuclear factor of activated T-cell isoform expression and regulation in human myometrium.
25987655 2015 Genome-wide analysis links NFATC2 with asparaginase hypersensitivity.
25818645 2015 Distinct spatial Ca2+ signatures selectively activate different NFAT transcription factor isoforms.
25797200 2015 NFAT-1, Sp-1, Sp-3, and miR-21: New regulators of chemokine C receptor 7 expression in mature human dendritic cells.
25735562 2015 NFAT1 promotes intratumoral neutrophil infiltration by regulating IL8 expression in breast cancer.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25376468 2015 Association of the Smad3 and NFATc2 gene polymorphisms and their serum levels with susceptibility to rheumatoid arthritis in Polish cohorts.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24931237 2014 Three transcription factors and the way immune cells affected by different plasma change in opposite ways in the development of the syndrome of pre-eclampsia.
24561192 2014 USP22 is a positive regulator of NFATc2 on promoting IL2 expression.
24551078 2014 CCAAT enhancer binding protein and nuclear factor of activated T cells regulate HIV-1 LTR via a novel conserved downstream site in cells of the monocyte-macrophage lineage.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24486774 2014 SALL4 and NFATC2: two major actors of interstitial 20q13.2 duplication.
24477908 2014 Smad and NFAT pathways cooperate to induce CD103 expression in human CD8 T lymphocytes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24173147 2014 Differential CTLA-4 expression in human CD4+ versus CD8+ T cells is associated with increased NFAT1 and inhibition of CD4+ proliferation.
24136923 2013 Nuclear translocation of nuclear factor of activated T cells (NFAT) as a quantitative pharmacodynamic parameter for tacrolimus.
24106272 2013 Early growth response-1 (EGR-1) and nuclear factor of activated T cells (NFAT) cooperate to mediate CD40L expression in megakaryocytes and platelets.
23918034 2014 Genome-wide association study (GWAS) for molar-incisor hypomineralization (MIH).
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23762456 2013 NFAT1 is highly expressed in, and regulates the invasion of, glioblastoma multiforme cells.
23665382 2013 NFATc2 recruits cJun homodimers to an NFAT site to synergistically activate interleukin-2 transcription.
23359789 2013 WNT5A-NFAT signaling mediates resistance to apoptosis in pancreatic cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23105117 2012 Human VRK2 (vaccinia-related kinase 2) modulates tumor cell invasion by hyperactivation of NFAT1 and expression of cyclooxygenase-2.
23060442 2012 Endorepellin affects angiogenesis by antagonizing diverse vascular endothelial growth factor receptor 2 (VEGFR2)-evoked signaling pathways: transcriptional repression of hypoxia-inducible factor 1? and VEGFA and concurrent inhibition of nuclear factor of activated T cell 1 (NFAT1) activation.
22986745 2012 Galectin-3 contributes to melanoma growth and metastasis via regulation of NFAT1 and autotaxin.
22911897 2012 Three-way translocation (X;20;16)(p11;q13;q23) in essential thrombocythemia implicates NFATC2 in dysregulation of CSF2 expression and megakaryocyte proliferation.
22787160 2012 Transcription factor NFAT1 activates the mdm2 oncogene independent of p53.
22767506 2012 Lipocalin 2, the TNF-like receptor TWEAKR and its ligand TWEAK act downstream of NFAT1 to regulate breast cancer cell invasion.
22718120 2012 NFATc2 is a potential therapeutic target in human melanoma.
22699055 2012 [Effect of hepatitis C virus core gene transfection on NFAT1 expression in human intrahepatic cholangiocarcinoma cells].
22627363 2012 NFAT1 and NFAT2 differentially regulate IL-17A expression in human T cells.
22363514 2012 Differences in MEF2 and NFAT transcriptional pathways according to human heart failure aetiology.
22333584 2012 Transcriptional regulation of the c-Myc promoter by NFAT1 involves negative and positive NFAT-responsive elements.
22116621 2012 NFAT regulates the expression of AIF-1 and IRT-1: yin and yang splice variants of neointima formation and atherosclerosis.
22045870 2012 Transcriptional activation of the IL31 gene by NFAT and STAT6.
21983832 2011 The kinase LRRK2 is a regulator of the transcription factor NFAT that modulates the severity of inflammatory bowel disease.
21964595 2011 Negative cross talk between NFAT1 and Stat5 signaling in breast cancer.
21871017 2011 NFAT promotes carcinoma invasive migration through glypican-6.
21803625 NKX2-3 variant rs11190140 is associated with IBD and alters binding of NFAT.
21799768 2011 Enhanced chromatin accessibility and recruitment of JUNB mediate the sustained IL-4 expression in NFAT1 deficient T helper 2 cells.
21628454 2011 Disruption of a nuclear NFATc2 protein stabilization loop confers breast and pancreatic cancer growth suppression by zoledronic acid.
21576369 2011 Interferon regulatory factor 2 binding protein 2 is a new NFAT1 partner and represses its transcriptional activity.
21325277 2011 Selective activation of the transcription factor NFAT1 by calcium microdomains near Ca2+ release-activated Ca2+ (CRAC) channels.
21282105 2011 Minocycline suppresses activation of nuclear factor of activated T cells 1 (NFAT1) in human CD4+ T cells.
21047202 2010 Using genetic and clinical factors to predict tacrolimus dose in renal transplant recipients.
20834230 2010 Heat shock factor 1 ameliorates proteotoxicity in cooperation with the transcription factor NFAT.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20609354 2010 Wnt/Ca2+/NFAT signaling maintains survival of Ph+ leukemia cells upon inhibition of Bcr-Abl.
20557936 2010 The C-terminal region of human NFATc2 binds cJun to synergistically activate interleukin-2 transcription.
20448330 2010 NFAT and AP1 are essential for the expression of a glioblastoma multiforme related IL-13Ra2 transcript.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20379146 2010 Biological pathway-based genome-wide association analysis identified the vasoactive intestinal peptide (VIP) pathway important for obesity.
20368097 2010 GATA3 siRNA inhibits the binding of NFAT1 to interleukin-13 promoter in human T cells.
20367554 2010 Brain-specific angiogenesis inhibitor 2 (BAI2) may be activated by proteolytic processing.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
20219685 2010 Pathway-based approaches to imaging genetics association studies: Wnt signaling, GSK3beta substrates and major depression.
20097868 2010 NFAT1 mediates placental growth factor-induced myelomonocytic cell recruitment via the induction of TNF-alpha.
20093726 2009 Calcineurin/NFAT signaling in lymphoid malignancies.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19900447 2010 NFAT-induced histone acetylation relay switch promotes c-Myc-dependent growth in pancreatic cancer cells.
19843528 2009 Transcriptional activation of hTERT, the human telomerase reverse transcriptase, by nuclear factor of activated T cells.
19833725 2009 Tyrosine phosphorylation of 3BP2 regulates B cell receptor-mediated activation of NFAT.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19505873 2009 Complementary quantitative proteomics reveals that transcription factor AP-4 mediates E-box-dependent complex formation for transcriptional repression of HDM2.
19458075 2009 Secreted frizzle-related protein 2 stimulates angiogenesis via a calcineurin/NFAT signaling pathway.
19318584 2009 A key regulatory role of the transcription factor NFATc2 in bronchial adenocarcinoma via CD8+ T lymphocytes.
19318479 2009 The NFATc2 gene is involved in a novel cloned translocation in a Ewing sarcoma variant that couples its function in immunology to oncology.
19286996 2009 microRNA 184 regulates expression of NFAT1 in umbilical cord blood CD4+ T cells.
19192391 2009 PKD2 interacts with Lck and regulates NFAT activity in T cells.
18973208 Poor in vitro induction of FOXP3 and ICOS in type 1 cytokine environment activated T-cells from children with type 1 diabetes.
18962896 2009 A distal cis-regulatory element, CNS-9, controls NFAT1 and IRF4-mediated IL-10 gene activation in T helper cells.
18931684 2008 Suppressed NFAT-dependent VEGFR1 expression and constitutive VEGFR2 signaling in infantile hemangioma.
18710929 2008 The transcription factor NFATc2 controls IL-6-dependent T cell activation in experimental colitis.
18676376 2008 Cooperative synergy between NFAT and MyoD regulates myogenin expression and myogenesis.
18675896 2008 Alternative splicing and expression of human and mouse NFAT genes.
18641302 2008 HIF-1alpha is up-regulated in activated mast cells by a process that involves calcineurin and NFAT.
18246125 2008 Selective activation of NFAT by promyelocytic leukemia protein.
18218901 2008 NFAT binding and regulation of T cell activation by the cytoplasmic scaffolding Homer proteins.
18097033 2008 Differential contribution of NFATc2 and NFATc1 to TNF-alpha gene expression in T cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17882263 2007 Requirement for O-linked N-acetylglucosaminyltransferase in lymphocytes activation.
17875758 2007 ATM, CTLA4, MNDA, and HEM1 in high versus low CD38 expressing B-cell chronic lymphocytic leukemia.
17785820 2007 Induction of the CTLA-4 gene in human lymphocytes is dependent on NFAT binding the proximal promoter.
17711847 2007 Structure-function analysis of the WIP role in T cell receptor-stimulated NFAT activation: evidence that WIP-WASP dissociation is not required and that the WIP NH2 terminus is inhibitory.
17588603 2007 Dimer composition and promoter context contribute to functional cooperation between AP-1 and NFAT.
17584983 2007 Nuclear factor of activated T cell mediates proinflammatory gene expression in response to mechanotransduction.
17467953 2007 Nine-amino-acid transactivation domain: establishment and prediction utilities.
17463169 2007 Deficient CD4+ CD25+ FOXP3+ T regulatory cells in acquired aplastic anemia.
17398070 2007 Cot/Tpl2 and PKCzeta cooperate in the regulation of the transcriptional activity of NFATc2 through the phosphorylation of its amino-terminal domain.
17377532 2007 Foxp3 controls regulatory T-cell function by interacting with AML1/Runx1.
17237447 2007 Increased levels of NF-ATc2 differentially regulate CD154 and IL-2 genes in T cells from patients with systemic lupus erythematosus.
17237388 2007 The B cell antigen receptor controls AP-1 and NFAT activity through Ras-mediated activation of Ral.
17082665 2006 Defective Th1 cytokine gene transcription in CD4+ and CD8+ T cells from Wiskott-Aldrich syndrome patients.
16888000 2006 Activation of NFAT signal in vivo leads to osteopenia associated with increased osteoclastogenesis and bone-resorbing activity.
16873067 2006 FOXP3 controls regulatory T cell function through cooperation with NFAT.
16849457 2006 Involvement of NFAT1 in B cell self-tolerance.
16690925 2006 Human immunodeficiency virus type 1 Tat increases cooperation between AP-1 and NFAT transcription factors in T cells.
16505480 2006 NFAT induces breast cancer cell invasion by promoting the induction of cyclooxygenase-2.
16497967 2006 Constitutive NF-kappaB and NFAT activation leads to stimulation of the BLyS survival pathway in aggressive B-cell lymphomas.
16473827 2006 The calcineurin phosphatase complex modulates immunogenic B cell responses.
16455648 2006 Proteolytic regulation of nuclear factor of activated T (NFAT) c2 cells and NFAT activity by caspase-3.
15897878 2005 Integrin alpha6beta4 promotes expression of autotaxin/ENPP2 autocrine motility factor in breast carcinoma cells.
15857835 2005 Nuclear factor of activated T cells and serum response factor cooperatively regulate the activity of an alpha-actin intronic enhancer.
15790807 2005 Transcriptional maps of 10 human chromosomes at 5-nucleotide resolution.
15790681 2005 Foxp3 interacts with nuclear factor of activated T cells and NF-kappa B to repress cytokine gene expression and effector functions of T helper cells.
15668245 2005 Identification of calcium-modulating cyclophilin ligand (CAML) as transducer of angiotensin II-mediated nuclear factor of activated T cells (NFAT) activation.
15632146 2005 Expression and function of the nuclear factor of activated T cells in colon carcinoma cells: involvement in the regulation of cyclooxygenase-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15471864 2004 The viral protein A238L inhibits cyclooxygenase-2 expression through a nuclear factor of activated T cell-dependent transactivation pathway.
15347678 2004 Interleukin (IL)-15 and IL-2 reciprocally regulate expression of the chemokine receptor CX3CR1 through selective NFAT1- and NFAT2-dependent mechanisms.
15292278 2004 Expression and regulation of NFAT (nuclear factors of activated T cells) in human CD34+ cells: down-regulation upon myeloid differentiation.
15271374 2004 Human interleukin-5 expression is synergistically regulated by histone acetyltransferase CBP/p300 and transcription factors C/EBP, NF-AT and AP-1.
15184502 2004 Nuclear factor of activated T cells balances angiogenesis activation and inhibition.
15144186 2004 Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry.
15121840 2004 A conserved docking motif for CK1 binding controls the nuclear localization of NFAT1.
15117942 2004 Dual role of sumoylation in the nuclear localization and transcriptional activation of NFAT1.
14657699 2003 Equivalent functional nuclear factor of activated T cell 1 mRNA and protein expression in cord blood and adult T cells.
12949493 2003 Structure of NFAT1 bound as a dimer to the HIV-1 LTR kappa B element.
12788643 2003 Regulation of T cell activation by HIV-1 accessory proteins: Vpr acts via distinct mechanisms to cooperate with Nef in NFAT-directed gene expression and to promote transactivation by CREB.
12656674 2003 Antisense-mediated loss of calcium homoeostasis endoplasmic reticulum protein (CHERP; ERPROT213-21) impairs Ca2+ mobilization, nuclear factor of activated T-cells (NFAT) activation and cell proliferation in Jurkat T-lymphocytes.
12594826 2003 NF-ATc2 induces apoptosis in Burkitt's lymphoma cells through signaling via the B cell antigen receptor.
12560487 2003 Early growth response proteins (EGR) and nuclear factors of activated T cells (NFAT) form heterodimers and regulate proinflammatory cytokine gene expression.
12482669 2002 Signaling pathways triggered by HIV-1 Tat in human monocytes to induce TNF-alpha.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12453415 2002 NFATc2-mediated repression of cyclin-dependent kinase 4 expression.
12370307 2002 Targeted disruption of NFATc3, but not NFATc4, reveals an intrinsic defect in calcineurin-mediated cardiac hypertrophic growth.
12093869 2002 Induction of NFATc2 expression by interleukin 6 promotes T helper type 2 differentiation.
12021260 2002 Protein kinase Czeta phosphorylates nuclear factor of activated T cells and regulates its transactivating activity.
11982754 2002 Localization of calcineurin/NFAT in human skin and psoriasis and inhibition of calcineurin/NFAT activation in human keratinocytes by cyclosporin A.
11956291 2002 Interferon regulatory factor 4 (IRF4) interacts with NFATc2 to modulate interleukin 4 gene expression.
11932239 2002 A genome-wide screen for normally methylated human CpG islands that can identify novel imprinted genes.
11911478 2002 Molecular mechanism of NFAT family proteins for differential regulation of the IL-2 and TNF-alpha promoters.
11877454 2002 NFAT: ubiquitous regulator of cell differentiation and adaptation.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
11438213 2001 Cyclosporin A effects during primary and secondary activation of human umbilical cord blood T lymphocytes.
11356192 2001 Binding and regulation of the transcription factor NFAT by the peptidyl prolyl cis-trans isomerase Pin1.
11231878 2000 Characterization of DNA binding, transcriptional activation, and regulated nuclear association of recombinant human NFATp.
11030334 2000 Concerted dephosphorylation of the transcription factor NFAT1 induces a conformational switch that regulates transcriptional activity.
10944115 2000 Integration of calcineurin and MEF2 signals by the coactivator p300 during T-cell apoptosis.
10821850 2000 Divergent hTAFII31-binding motifs hidden in activation domains.
10737800 2000 Shotgun sequencing of the human transcriptome with ORF expressed sequence tags.
10611249 2000 Integration of calcium and cyclic AMP signaling pathways by 14-3-3.
10207088 1999 Reciprocal modulatory interaction between human immunodeficiency virus type 1 Tat and transcription factor NFAT1.
10089876 1999 Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT.
9660947 1998 Selective inhibition of NFAT activation by a peptide spanning the calcineurin targeting site of NFAT.
9625762 1998 Nuclear factor of activated T cells (NFAT)-dependent transactivation regulated by the coactivators p300/CREB-binding protein (CBP).
9510247 1998 Structure of the DNA-binding domains from NFAT, Fos and Jun bound specifically to DNA.
9498773 1998 Distinct NFAT family proteins are involved in the nuclear NFAT-DNA binding complexes from human thymocyte subsets.
9143705 1997 Transcription factors of the NFAT family: regulation and function.
9111316 1997 Expression of NFAT-family proteins in normal human T cells.
8943202 1996 NF-AT-Driven interleukin-4 transcription potentiated by NIP45.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8834464 1996 Suppression of the human immunodeficiency virus long terminal repeat by CD8+ T cells is dependent on the NFAT-1 element.
8668213 1996 Recombinant NFAT1 (NFATp) is regulated by calcineurin in T cells and mediates transcription of several cytokine genes.
8397339 1993 The T-cell transcription factor NFATp is a substrate for calcineurin and interacts with Fos and Jun.
8202141 1994 NF-AT components define a family of transcription factors targeted in T-cell activation.
7999066 1994 Human immunodeficiency virus type-1 tat enhances interleukin-2 promoter activity through synergism with phorbol ester and calcium-mediated activation of the NF-AT cis-regulatory motif.
7887301 1994 Cloning and characterization of NF-ATc and NF-ATp: the cytoplasmic components of NF-AT.
7842733 1995 Cloning and chromosomal localization of the human and murine genes for the T-cell transcription factors NFATc and NFATp.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].
7650486 1995 Activation and expression of the nuclear factors of activated T cells, NFATp and NFATc, in human natural killer cells: regulation upon CD16 ligand binding.