Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.43
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
ovarian cancer 8491 8.8e-08
osteosarcoma 7933 1.5e-07
tuberculosis 1563 1.9e-04

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.744 1.5e-07
tuberculosis 1.500 1.9e-04
ovarian cancer -2.000 8.8e-08

Gene RIF (4)

PMID Text
18295596 Our findings define a pathway involving CD28 binding to Grb-2 and its co-operativity with Vav1 in the regulation of T-cell co-stimulation.
18031784 NFAT plays a role in SV40 infection via transcriptional control of Simian Virus 40.
17079331 Our results demonstrate NFAT expression and activation in native human vessels and point out A-285222 as a powerful pharmacological blocker of NFAT signaling in the vasculature.
12615919 CNAIP is a ITAM-containing protein that activates the calcineurin/NFAT-signaling pathway and the downstream cytokine gene promoters

AA Sequence

MENQPVRWRALPGLPRPPGLPAAPWLLLGVLLLPGTLRLAGGQSVTHTGLPIMASLANTAISFSCRITYP      1 - 70
YTPQFKVFTVSYFHEDLQGQRSPKKPTNCHPGLGTENQSHTLDCQVTLVLPGASATGTYYCSVHWPHSTV     71 - 140
RGSGTFILVRDAGYREPPQSPQKLLLFGFTGLLSVLSVVGTALLLWNKKRMRGPGKDPTRKCPDPRSASS    141 - 210
PKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYENL              211 - 270
//

Text Mined References (11)

PMID Year Title
18295596 2008 CD28 and Grb-2, relative to Gads or Grap, preferentially co-operate with Vav1 in the activation of NFAT/AP-1 transcription.
18031784 2008 Nuclear factor of activated T-cells (NFAT) plays a role in SV40 infection.
17079331 2007 Novel blocker of NFAT activation inhibits IL-6 production in human myometrial arteries and reduces vascular smooth muscle cell proliferation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15461802 2004 A genome annotation-driven approach to cloning the human ORFeome.
15143214 2004 NFAM1, an immunoreceptor tyrosine-based activation motif-bearing molecule that regulates B cell development and signaling.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12693554 2003 Characterization of long cDNA clones from human adult spleen. II. The complete sequences of 81 cDNA clones.
12615919 2003 Calcineurin/nuclear factors of activated T cells (NFAT)-activating and immunoreceptor tyrosine-based activation motif (ITAM)-containing protein (CNAIP), a novel ITAM-containing protein that activates the calcineurin/NFAT-signaling pathway.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.