Property Summary

NCBI Gene PubMed Count 10
PubMed Score 3.32
PubTator Score 2.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 8.8e-08
osteosarcoma 7950 1.5e-07
tuberculosis 2010 1.9e-04
Disease Target Count Z-score Confidence
Yellow fever 16 3.007 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.744 1.5e-07
ovarian cancer -2.000 8.8e-08
tuberculosis 1.500 1.9e-04

Gene RIF (4)

AA Sequence

MENQPVRWRALPGLPRPPGLPAAPWLLLGVLLLPGTLRLAGGQSVTHTGLPIMASLANTAISFSCRITYP      1 - 70
YTPQFKVFTVSYFHEDLQGQRSPKKPTNCHPGLGTENQSHTLDCQVTLVLPGASATGTYYCSVHWPHSTV     71 - 140
RGSGTFILVRDAGYREPPQSPQKLLLFGFTGLLSVLSVVGTALLLWNKKRMRGPGKDPTRKCPDPRSASS    141 - 210
PKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYENL              211 - 270
//

Text Mined References (11)

PMID Year Title