Property Summary

NCBI Gene PubMed Count 39
PubMed Score 235.50
PubTator Score 104.71

Knowledge Summary

Patent

No data available

Expression

 GO Component (2)

Gene RIF (34)

PMID Text
26345820 ChIP experiments confirmed that Pdx1 activates the expression of the downstream transcription factors, Ngn3 and Pax6, by combined with the promoter regions of insulin (Insulin-P), Ngn3 (Ngn3-P), and Pax6 (Pax6-P).
26288179 NGN3 expression in the adult human exocrine pancreas marks a dedifferentiating cell population.
25650326 conclude that NEUROG3 is essential for endocrine pancreas development in humans and that as little as 10% NEUROG3 is sufficient for formation of pancreatic endocrine cells
25120094 NEUROG3 deficiency produces a rare clinical syndrome characterised by severe malabsorptive diarrhoea from early life and mild diabetes with a variable age of onset.
24969979 The expression of transcription factor Ngn3 and pancreatic mesenchymal microenvironment are important and necessary to promote pancreatic progenitors differentiated to islet cells regardless of pancreatic development or islets regeneration.
24925797 Activation of the developmental pathway neurogenin-3/microRNA-7a regulates cholangiocyte proliferation in response to injury.
24493854 Prospectively isolated NGN3-expressing progenitors from human embryonic stem cells give rise to pancreatic endocrine cells.
24134759 Recessively inherited NEUROG-3 mutations were originally identified in three patients with unexplained congenital malabsorptive diarrhea and an absence of EC.
23349771 Data indicate associations of SNPs in eight loci CXCR4, HHEX, FOXA2, NGN3, TCF7L2, FLJ39370 (C4orf32), LOC646279 (RPL21P7) and THADA with body mass index (BMI) and weight.
22606327 Ngn3-mediated pancreatic duct-to-endocrine cell reprogramming was measured employing genome wide mRNA profiling.
22266316 CCAR1 is a novel partner of Ngn3 in mediating endocrine differentiation.
21814221 The variants in HNFA and NEUROG3 indicate a strong predisposition of normal-weight/lean subjects to T2D in North Indians.
21739268 Gastrin-positive neuroendocrine tumors, whether of duodenal or pancreatic origin, frequently expressed PDX1 (17/18), ISL1 (14/18), and NGN3 (14/18).
21378176 Severe deficiency of neurogenin 3 causes a rare novel subtype of permanent neonatal diabetes. This finding confirms the essential role of NEUROG3 in islet development and function in humans
21099270 The important role of Ngn3 as a master regulator of endocrine pancreas development directs attention to finding therapeutic approaches to enhance Ngn3 expression in diabetes as a means to increase beta cell mass and functions.
20807725 These results support an important inter-species difference in regulating insulin exocytosis where RAB3B is the most expressed isoform in human islets.
20668890 Ngn3-Cre-based lineage tracing showed that pdx-1-expressing cells differentiated to all the types of pancreatic cells, while Ngn3 marked endocrine-specific progenitors.
19538245 mutations of NEUROG3 gene are not a common cause of neonatal/infancy/childhood-onset diabetes
19336475 Observational study of gene-disease association. (HuGE Navigator)
19307926 Tumors and MEN1 nontumorous endocrine cells showed a prominent cytoplasmatic NEUROG3 and NEUROD1 expression
18854154 Knockdown of neurogenin 3 (NEUROG3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18461161 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18210030 Observational study of gene-disease association. (HuGE Navigator)
18093211 Observational study of gene-disease association. (HuGE Navigator)
18072012 A genetic variation in the NGN3 gene may be among the genetic determinants involved in the pathogenesis of diabetes.
18072012 Observational study of gene-disease association. (HuGE Navigator)
17922104 The Notch/Ngn3 signalling network is intact and functional in adult islets.
17146417 Observational study of gene-disease association. (HuGE Navigator)
16873704 Observational study of gene-disease association. (HuGE Navigator)
15277395 Observational study of gene-disease association. (HuGE Navigator)
15277395 Polymorphism contributes to glucose intolerance in a South Indian population.
12403815 adult human pancreatic duct cells can be converted into insulin-expressing cells after ectopic, adenovirus-mediated expression of the class B basic helix-loop-helix factor neurogenin 3
11270683 Observational study of gene-disease association. (HuGE Navigator)
11206403 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MTPQPSGAPTVQVTRETERSFPRASEDEVTCPTSAPPSPTRTRGNCAEAEEGGCRGAPRKLRARRGGRSR      1 - 70
PKSELALSKQRRSRRKKANDRERNRMHNLNSALDALRGVLPTFPDDAKLTKIETLRFAHNYIWALTQTLR     71 - 140
IADHSLYALEPPAPHCGELGSPGGSPGDWGSLYSPVSQAGSLSPAASLEERPGLLGATFSACLSPGSLAF    141 - 210
SDFL                                                                      211 - 214
//

Text Mined References (42)

PMID Year Title
26345820 2015 Pdxl and its role in activating Ngn3 and Pax6 to induce differentiation of iPSCs into islet ? cells.
26288179 2015 Neurogenin 3 Expressing Cells in the Human Exocrine Pancreas Have the Capacity for Endocrine Cell Fate.
25650326 2015 The Basic Helix-Loop-Helix Transcription Factor NEUROG3 Is Required for Development of the Human Endocrine Pancreas.
25416956 2014 A proteome-scale map of the human interactome network.
25120094 2014 Neurogenin 3 is important but not essential for pancreatic islet development in humans.
24969979 2014 Short-reactivation of neurogenin-3 and mesenchymal microenvironment is require for ?-cells differentiation during fetal pancreas development and islet regeneration.
24925797 2014 Activation of the developmental pathway neurogenin-3/microRNA-7a regulates cholangiocyte proliferation in response to injury.
24493854 2014 Prospectively isolated NGN3-expressing progenitors from human embryonic stem cells give rise to pancreatic endocrine cells.
24134759 2013 Extremely rare cause of congenital diarrhea: enteric anendocrinosis.
23349771 2013 Association study of 25 type 2 diabetes related Loci with measures of obesity in Indian sib pairs.
22606327 2012 Plasticity of adult human pancreatic duct cells by neurogenin3-mediated reprogramming.
22266316 2012 CCAR1 is required for Ngn3-mediated endocrine differentiation.
21814221 2011 Association of variants in genes involved in pancreatic ?-cell development and function with type 2 diabetes in North Indians.
21739268 2011 Hormonally defined pancreatic and duodenal neuroendocrine tumors differ in their transcription factor signatures: expression of ISL1, PDX1, NGN3, and CDX2.
21378176 2011 Permanent Neonatal Diabetes and Enteric Anendocrinosis Associated With Biallelic Mutations in NEUROG3.
21099270 Neurogenin3: a master regulator of pancreatic islet differentiation and regeneration.
20807725 2010 In vitro expression of NGN3 identifies RAB3B as the predominant Ras-associated GTP-binding protein 3 family member in human islets.
20668890 2011 Genetic lineage tracing, a powerful tool to investigate the embryonic organogenesis and adult organ maintenance of the pancreas.
19538245 2009 Mutations in IAPP and NEUROG3 genes are not a common cause of permanent neonatal/infancy/childhood-onset diabetes.
19336475 2009 Integrated associations of genotypes with multiple blood biomarkers linked to coronary heart disease risk.
19307926 2009 Neurogenin 3 and neurogenic differentiation 1 are retained in the cytoplasm of multiple endocrine neoplasia type 1 islet and pancreatic endocrine tumor cells.
18461161 2008 Post genome-wide association studies of novel genes associated with type 2 diabetes show gene-gene interaction and high predictive value.
18210030 2008 Analysis of novel risk loci for type 2 diabetes in a general French population: the D.E.S.I.R. study.
18093211 2008 Gender and neurogenin3 influence the pathogenesis of ketosis-prone diabetes.
18072012 2008 Genetic variation of Neurogenin 3 is slightly associated with hyperproinsulinaemia and progression toward type 2 diabetes.
17922104 2007 Notch signalling suppresses apoptosis in adult human and mouse pancreatic islet cells.
17146417 2006 NEUROG3 variants and type 2 diabetes in Italians.
16873704 2006 Association studies of variants in the genes involved in pancreatic beta-cell function in type 2 diabetes in Japanese subjects.
16855267 2006 Mutant neurogenin-3 in congenital malabsorptive diarrhea.
16511571 2006 IA1 is NGN3-dependent and essential for differentiation of the endocrine pancreas.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15277395 2004 Polymorphic variations in the neurogenic differentiation-1, neurogenin-3, and hepatocyte nuclear factor-1alpha genes contribute to glucose intolerance in a South Indian population.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14576336 2004 Neurogenin3 activates the islet differentiation program while repressing its own expression.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12403815 2002 Recapitulation of embryonic neuroendocrine differentiation in adult human pancreatic duct cells expressing neurogenin 3.
11270683 2001 Variants of neurogenin 3 gene are not associated with Type II diabetes in Japanese subjects.
11246894 2001 Mutations in the coding region of the neurogenin 3 gene (NEUROG3) are not a common cause of maturity-onset diabetes of the young in Japanese subjects.
11206403 2001 Polymorphisms in the neurogenin 3 gene (NEUROG) and their relation to altered insulin secretion and diabetes in the Danish Caucasian population.
10677506 2000 neurogenin3 is required for the development of the four endocrine cell lineages of the pancreas.
9000438 1996 neurogenins, a novel family of atonal-related bHLH transcription factors, are putative mammalian neuronal determination genes that reveal progenitor cell heterogeneity in the developing CNS and PNS.