Property Summary

NCBI Gene PubMed Count 13
PubMed Score 138.72
PubTator Score 53.01

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
facioscapulohumeral dystrophy 288 1.7e-06
Disease Target Count Z-score Confidence
Retinitis pigmentosa 58 13 5.132 2.6
Parkinson's disease 392 3.679 1.8

Expression

  Differential Expression (1)

Disease log2 FC p
facioscapulohumeral dystrophy 3.000 1.7e-06

Gene RIF (8)

AA Sequence

MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAG      1 - 70
AEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLP     71 - 140
TFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSP    141 - 210
ASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI            211 - 272
//

Text Mined References (13)

PMID Year Title