Property Summary

NCBI Gene PubMed Count 18
PubMed Score 38.72
PubTator Score 21.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma -1.200 9.4e-03
posterior fossa group A ependymoma -2.000 1.1e-10
oligodendroglioma -1.300 3.3e-03
glioblastoma -1.800 2.3e-09
atypical teratoid / rhabdoid tumor -1.900 4.4e-07
primitive neuroectodermal tumor -1.500 4.8e-03
pediatric high grade glioma -1.700 1.6e-05
group 4 medulloblastoma 2.500 3.1e-05
pilocytic astrocytoma -2.000 9.6e-07
subependymal giant cell astrocytoma -2.058 2.2e-02
psoriasis -2.900 4.8e-57

 GO Component (1)

Gene RIF (9)

PMID Text
22752091 Downregulation of NEUROD2 is associated with neurodevelopmental defects in trisomies 18.
20880594 The results of this study did not provide evidence for an involvement of NEUROD2 polymorphisms in the pathophysiology of alcohol dependence.
20880594 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19086053 Observational study of gene-disease association. (HuGE Navigator)
17117180 Observational study of gene-disease association. (HuGE Navigator)
16607387 Lower neuroD2 mRNA levels was found in opiate-dependent individuals in the cortex and hippocampus.
11900979 expression during trophoblast invasion
11473083 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLTRLFSEPGLLSDVPKFASWGDGEDDEPRSDKGDAPPPPPPAPGPGAPGPARAAKPVPLRGEEGTEATL      1 - 70
AEVKEEGELGGEEEEEEEEEEGLDEAEGERPKKRGPKKRKMTKARLERSKLRRQKANARERNRMHDLNAA     71 - 140
LDNLRKVVPCYSKTQKLSKIETLRLAKNYIWALSEILRSGKRPDLVSYVQTLCKGLSQPTTNLVAGCLQL    141 - 210
NSRNFLTEQGADGAGRFHGSGGPFAMHPYPYPCSRLAGAQCQAAGGLGGGAAHALRTHGYCAAYETLYAA    211 - 280
AGGGGASPDYNSSEYEGPLSPPLCLNGNFSLKQDSSPDHEKSYHYSMHYSALPGSRPTGHGLVFGSSAVR    281 - 350
GGVHSENLLSYDMHLHHDRGPMYEELNAFFHN                                          351 - 382
//

Text Mined References (18)

PMID Year Title
22752091 2012 Novel neurodevelopmental information revealed in amniotic fluid supernatant transcripts from fetuses with trisomies 18 and 21.
20880594 2011 Lack of association between SNPs in the NEUROD2 gene and alcohol dependence in a German patient sample.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19086053 2009 Identification of new putative susceptibility genes for several psychiatric disorders by association analysis of regulatory and non-synonymous SNPs of 306 genes involved in neurotransmission and neurodevelopment.
17117180 2006 HapMap-based study of the 17q21 ERBB2 amplicon in susceptibility to breast cancer.
16607387 2006 A possible impact of the neuroD2 transcription factor on the development of drug abusing behavior.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14732494 2004 NEUROD1 acts in vitro as an upstream regulator of NEUROD2 in trophoblast cells.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11900979 2002 The proneural genes NEUROD1 and NEUROD2 are expressed during human trophoblast invasion.
11732772 2001 NeuroD homologue expression during cortical development in the human brain.
11473083 2001 NeuroD/beta2 gene G-->A polymorphism may affect onset pattern of type 1 diabetes in Japanese.
10662545 2000 Physical map of 17p13 and the genes adjacent to p53.
10640683 1999 Interaction of PKN with a neuron-specific basic helix-loop-helix transcription factor, NDRF/NeuroD2.
10209266 1999 Identification and analysis of the promoter region of the human NeuroD-related factor (NDRF)1.
9748526 1998 Phosphorylation and spatiotemporal distribution of KW8 (NDRF/NeuroD2), a NeuroD family basic helix-loop-helix protein.
9119405 1997 NEUROD2 and NEUROD3 genes map to human chromosomes 17q12 and 5q23-q31 and mouse chromosomes 11 and 13, respectively.
8816493 1996 NeuroD2 and neuroD3: distinct expression patterns and transcriptional activation potentials within the neuroD gene family.