Property Summary

NCBI Gene PubMed Count 98
PubMed Score 344.40
PubTator Score 195.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -1.500 2.1e-02
Astrocytoma, Pilocytic -2.800 1.8e-04
atypical teratoid / rhabdoid tumor -3.600 1.2e-07
ependymoma -1.800 4.1e-02
gastric carcinoma -1.100 4.3e-02
glioblastoma -2.100 4.9e-04
group 3 medulloblastoma 2.900 3.2e-02
medulloblastoma, large-cell 1.700 4.9e-02
oligodendroglioma -1.500 3.2e-02
ovarian cancer -1.200 1.1e-05
pancreatic cancer -1.300 2.3e-02
pediatric high grade glioma -2.200 3.6e-03
pituitary cancer 2.100 4.2e-03
subependymal giant cell astrocytoma -5.820 8.6e-04

Protein-protein Interaction (5)

Gene RIF (80)

AA Sequence

MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEEDSLRNGGEEEDEDEDLEEEE      1 - 70
EEEEEDDDQKPKRRGPKKKKMTKARLERFKLRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKI     71 - 140
ETLRLAKNYIWALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQNQDMPPHLPTA    141 - 210
SASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSIN    211 - 280
GNFSFKHEPSAEFEKNYAFTMHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL    281 - 350
NAIFHD                                                                    351 - 356
//

Text Mined References (99)

PMID Year Title