Property Summary

NCBI Gene PubMed Count 9
PubMed Score 3.16
PubTator Score 2.45

Knowledge Summary

Patent

No data available

Expression

 IMPC Phenotype (1)

Gene RIF (1)

AA Sequence

MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFAHGVCFSREPLAPGQVFLVEI      1 - 70
EEKELGWCGHLRLGLTALDPASLAPVPEFSLPDLVNLGHTWVFAITRHHNRVPREGRPEAEAAAPSRPPT     71 - 140
LLVEPYLRIEQFRIPRDRLVGRSRPGLYSHLLDQLYELNVLPPTARRSRLGVLFCPRPDGTADMHIIING    141 - 210
EDMGPSARGLPAAQPLYAVVDVFASTKSVRLVQLEYGLPSLQTLCRLVIQRSMVHRLAIDGLHLPKELKD    211 - 280
FCKYE                                                                     281 - 285
//

Text Mined References (9)

PMID Year Title