Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.62
PubTator Score 0.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
active Crohn's disease -1.164 6.3e-03
active ulcerative colitis -1.633 5.9e-03
atypical teratoid / rhabdoid tumor -1.800 7.2e-04
Breast cancer 2.800 3.1e-24
Duchenne muscular dystrophy 1.004 5.6e-05
gastric carcinoma 1.100 3.5e-02
interstitial cystitis 1.200 3.1e-04
intraductal papillary-mucinous adenoma (... -1.800 5.3e-04
invasive ductal carcinoma -1.600 4.8e-04
juvenile dermatomyositis 1.290 1.1e-09
medulloblastoma -1.100 4.0e-02
medulloblastoma, large-cell -1.600 4.8e-02
ovarian cancer 1.600 5.6e-05
pancreatic cancer 1.600 1.3e-02
primary pancreatic ductal adenocarcinoma 1.221 1.1e-02

Gene RIF (1)

AA Sequence

MGNTVHRTLPDPSPPARLLATRPCCGPGPERRPVLGEAPRFHAQAKGKNVRLDGHSRRATRRNSFCNGVT      1 - 70
FTQRPIRLYEQVRLRLVAVRPGWSGALRFGFTAHDPSLMSAQDIPKYACPDLVTRPGYWAKALPENLALR     71 - 140
DTVLAYWADRHGRVFYSVNDGEPVLFHCGVAVGGPLWALIDVYGITDEVQLLESAFADTLTPARLSQARF    141 - 210
SACLPPSSHDAANFDNNELENNQVVAKLGHLALGRAPGPPPADAAAAAIPCGPRERPRPASSPALLEADL    211 - 280
RFHATRGPDVSLSADRKVACAPRPDGGRTLVFSERPLRPGESLFVEVGRPGLAAPGALAFGITSCDPGVL    281 - 350
RPNELPADPDALLDRKEYWVVARAGPVPSGGDALSFTLRPGGDVLLGINGRPRGRLLCVDTTQALWAFFA    351 - 420
VRGGVAGQLRLLGTLQSSPATTTPSGSLSGSQDDSDSDMTFSVNQSSSASESSLVTAPSSPLSPPVSPVF    421 - 490
SPPEPAGIKNGECTVCFDGEVDTVIYTCGHMCLCHSCGLRLKRQARACCPICRRPIKDVIKIYRP         491 - 555
//

Text Mined References (7)

PMID Year Title