Property Summary

NCBI Gene PubMed Count 13
PubMed Score 47.37
PubTator Score 10.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
active ulcerative colitis -2.480 4.4e-03
acute myeloid leukemia 1.500 4.1e-02
adrenocortical carcinoma 2.171 2.8e-04
Atopic dermatitis 1.100 4.6e-03
Breast cancer 3.300 2.8e-02
cystic fibrosis 1.173 8.1e-06
ductal carcinoma in situ 1.300 6.0e-03
ependymoma -2.200 2.1e-02
fibroadenoma 1.200 4.3e-03
group 4 medulloblastoma 1.200 1.7e-02
invasive ductal carcinoma 2.100 5.0e-02
lung adenocarcinoma 1.142 7.1e-03
lung cancer 1.500 6.8e-05
lung carcinoma 1.300 1.9e-10
malignant mesothelioma 2.200 1.0e-07
nephrosclerosis 1.975 5.1e-03
non primary Sjogren syndrome sicca -1.100 1.5e-02
non-small cell lung cancer 1.839 3.2e-16
oligodendroglioma -1.500 1.6e-02
osteosarcoma 2.144 1.2e-02
ovarian cancer 1.100 6.8e-03
Pick disease -1.500 8.1e-03
psoriasis 1.800 3.6e-03
severe Alzheimer's disease -1.217 3.4e-02
subependymal giant cell astrocytoma -1.993 2.3e-02

Gene RIF (4)

AA Sequence

MALERLCSVLKVLLITVLVVEGIAVAQKTQDGQNIGIKHIPATQCGIWVRTSNGGHFASPNYPDSYPPNK      1 - 70
ECIYILEAAPRQRIELTFDEHYYIEPSFECRFDHLEVRDGPFGFSPLIDRYCGVKSPPLIRSTGRFMWIK     71 - 140
FSSDEELEGLGFRAKYSFIPDPDFTYLGGILNPIPDCQFELSGADGIVRSSQVEQEEKTKPGQAVDCIWT    141 - 210
IKATPKAKIYLRFLDYQMEHSNECKRNFVAVYDGSSSIENLKAKFCSTVANDVMLKTGIGVIRMWADEGS    211 - 280
RLSRFRMLFTSFVEPPCTSSTFFCHSNMCINNSLVCNGVQNCAYPWDENHCKEKKKAGVFEQITKTHGTI    281 - 350
IGITSGIVLVLLIISILVQVKQPRKKVMACKTAFNKTGFQEVFDPPHYELFSLRDKEISADLADLSEELD    351 - 420
NYQKMRRSSTASRCIHDHHCGSQASSVKQSRTNLSSMELPFRNDFAQPQPMKTFNSTFKKSSYTFKQGHE    421 - 490
CPEQALEDRVMEEIPCEIYVRGREDSAQASISIDF                                       491 - 525
//

Text Mined References (15)

PMID Year Title