Property Summary

NCBI Gene PubMed Count 20
PubMed Score 11.63
PubTator Score 10.42

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.200 2.6e-02
astrocytic glioma -1.100 1.2e-02
atypical teratoid / rhabdoid tumor -1.900 8.9e-05
cystic fibrosis 1.300 3.0e-03
ependymoma -1.300 2.2e-02
glioblastoma -1.200 2.1e-03
group 4 medulloblastoma -1.200 1.5e-02
medulloblastoma, large-cell -1.500 1.5e-02
oligodendroglioma -1.100 5.9e-03
Pick disease -1.100 1.4e-03
primitive neuroectodermal tumor -1.200 1.0e-02
psoriasis -1.600 1.1e-15

Gene RIF (6)

AA Sequence

MIHGRSVLHIVASLIILHLSGATKKGTEKQTTSETQKSVQCGTWTKHAEGGIFTSPNYPSKYPPDRECIY      1 - 70
IIEAAPRQCIELYFDEKYSIEPSWECKFDHIEVRDGPFGFSPIIGRFCGQQNPPVIKSSGRFLWIKFFAD     71 - 140
GELESMGFSARYNFTPDPDFKDLGALKPLPACEFEMGGSEGIVESIQIMKEGKATASEAVDCKWYIRAPP    141 - 210
RSKIYLRFLDYEMQNSNECKRNFVAVYDGSSSVEDLKAKFCSTVANDVMLRTGLGVIRMWADEGSRNSRF    211 - 280
QMLFTSFQEPPCEGNTFFCHSNMCINNTLVCNGLQNCVYPWDENHCKEKRKTSLLDQLTNTSGTVIGVTS    281 - 350
CIVIILIIISVIVQIKQPRKKYVQRKSDFDQTVFQEVFEPPHYELCTLRGTGATADFADVADDFENYHKL    351 - 420
RRSSSKCIHDHHCGSQLSSTKGSRSNLSTRDASILTEMPTQPGKPLIPPMNRRNILVMKHSYSQDAADAC    421 - 490
DIDEIEEVPTTSHRLSRHDKAVQRFCLIGSLSKHESEYNTTRV                               491 - 533
//

Text Mined References (22)

PMID Year Title