Property Summary

NCBI Gene PubMed Count 41
PubMed Score 5.33
PubTator Score 71.11

Knowledge Summary

Patent

No data available

Expression

Gene RIF (36)

PMID Text
26459749 Net1 mRNA and protein levels in non-small cell lung cancer tissues were significantly elevated compared with those in their corresponding nontumor tissues.
26456332 AMPK phosphorylation of the RHOA guanine nucleotide exchange factor NET1A inhibits extracellular matrix degradation, an early step in cell invasion
26080853 Simultaneous silencing of NET-1 and survivin using one-chain-double-target siRNA thus provides an advantageous alternative in the development of therapeutics for skin squamous cell carcinoma .
25588829 These data indicate that Net1A acetylation regulates its subcellular localization to impact on RhoA activity and actin cytoskeletal organization.
25486363 Net1A plays a plays a previously unrecognized, Rho GTPase-independent role in controlling ATM activity and downstream signaling after DNA damage to impact cell survival.
25113254 High expression of neuroepithelial transforming gene 1 was associated with hepatocellular carcinoma.
24942521 NET1 was associated with comorbidity of oppositional defiant disorder and symptoms in Attention-deficit/hyperactivity disorder probands
24375299 Data suggests that NET1 may be of prognostic significance in the clinical management of gastric adenocarcinoma
24196235 The overexpression of NET-1 in tumor cells may be closely related to the malignant phenotype of skin squamous cell carcinoma including proliferation, invasion and tumor growth.
23945136 NET1 expression is elevated in OAC and its pre-malignant phenotype, Barrett's oesophagus. NET1 promotes OAC cell invasion and proliferation.
23872233 A combination of NET1 (rs2242447) and SNAP-25 (rs3746544) is a risk factor for ADHD.
23864709 Results identify Net1 as a novel regulator of mitosis and indicate that altered expression of Net1, as occurs in human cancers, may adversely affect genomic stability.
23689132 A previously unrecognized role for the Net1A isoform in controlling FAK activation during planar cell movement.
23636606 NET-1 and VEGF silencing play a key role in inhibiting hepatocellular cell proliferation, promoting apoptosis, and reducing angiogenesis.
23184663 Rac1 activation causes relocalization of Net1 isoforms outside the nucleus and stimulates Net1A catalytic activity.
22927407 Net -1 frameshifting on a noncanonical sequence in a herpes simplex virus drug-resistant mutant is stimulated by nonstop mRNA.
22343628 Net1 is a CARMA-interacting molecule and brings important information on the molecular mechanisms that control NF-kappaB transcriptional activity
21390328 Existence of a functional Net1/RhoA signaling pathway within the nucleus of the cell and this implicates them in the DNA damage response.
21373644 A mechanism involving the nuclear GEFs Ect2 and Net1 for activating RhoB after genotoxic stress, thereby facilitating cell death after treatment with DNA damaging agents.
21284875 NET1 plays an role in gastric cancer cell migration and invasion. The gene expression profile further elucidates the molecular mechanisms underpinning NET1-mediated aggressive GC cell behaviour.
20547485 Smad3 regulates RhoA activation and cytoskeletal reorganization by controlling NET1 in TGF-beta1-induced ARPE-19 cells.
20078975 RNAi targeting NET-1 gene effectively down-regulates the expression of NET-1 in A431 cells, leading to an inhibition of proliferation, migration and infiltration.
19586902 Net1 requires interaction with PDZ domain proteins, such as Dlg1, to protect it from proteasome-mediated degradation and to maximally stimulate RhoA and that this interaction is regulated by cell-cell contact.
19124484 NET1 and integrin alpha6beta4 coexpression is independently associated with the development of distant metastasis in breast cancer.
18827818 the importance of NET1 as a driver of tumour cell invasion
18509476 data highlight the importance of Net1 in controlling RhoA and p38 MAPK mediated cell survival in cells exposed to DNA damaging agents
18478931 NET-1 protein is expressed in cytoplasm of HCC cells as irregular granules near Golgi apparatus, and may promote the uncontrolled proliferation and abnormal differentiation in HCC cells.
18214716 study concludes expression of NET-1 may relate to proliferation, metastasis & clinic stages of hepatocellular carcinoma (HCC); expression in HCC tissues may positively correlate to TMN stages; expression in HCC tissues was positively correlated with PCNA
17938206 These results suggest that the interaction between Net1 and Dlg1 may contribute to the mechanism of Net1-mediated transformation.
16741933 Observational study of gene-disease association. (HuGE Navigator)
16552434 The putative role for NET1 genes may provide important targets for intervention in Gastric adenocarcinoma, evidenced by their role in promoting invasion and proliferation, key phenotypic hallmarks of cancer cells.
16385451 Observational study of gene-disease association. (HuGE Navigator)
15719398 Observational study of gene-disease association. (HuGE Navigator)
15717291 Observational study of gene-disease association. (HuGE Navigator)
15684429 PAK1 negatively regulates the activity of NET1
15611121 NET1 has roles in stimulating cytoskeletal reorganization and in transforming cells

AA Sequence

MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGSELDGRCSLRRGSSFTFLTPGPNWDFTLKRKRR      1 - 70
EKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTIQSFTLRGDHRSPASAQKFSS     71 - 140
RSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEAIYEMSRGEQDLIEDLKLARKAYHDPMLKLSIM    141 - 210
SEEELTHIFGDLDSYIPLHEDLLTRIGEATKPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQK    211 - 280
KQDPRVQDFLQRCLESPFSRKLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVL    281 - 350
SDINLKKGESECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE    351 - 420
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPAQSHTLQANDVFHKQ    421 - 490
QWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRASTVSSVTQVEVDENAYRCGSGM    491 - 560
QMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV                                      561 - 596
//

Text Mined References (46)

PMID Year Title
26459749 2015 Neuroepithelial transforming gene 1 functions as a potential prognostic marker for patients with non-small cell lung cancer.
26456332 2015 Identification of AMPK Phosphorylation Sites Reveals a Network of Proteins Involved in Cell Invasion and Facilitates Large-Scale Substrate Prediction.
26080853 2015 Inhibition of skin squamous cell carcinoma proliferation and promote apoptosis by dual silencing of NET-1 and survivin.
25588829 2015 Acetylation of the RhoA GEF Net1A controls its subcellular localization and activity.
25486363 2014 Rho GTPase independent regulation of ATM activation and cell survival by the RhoGEF Net1A.
25113254 2014 A functional and protein-protein interaction analysis of neuroepithelial cell transforming gene 1 in hepatocellular carcinoma.
24942521 2015 The possible involvement of genetic variants of NET1 in the etiology of attention-deficit/hyperactivity disorder comorbid with oppositional defiant disorder.
24375299 2014 Prognostic significance of neuroepithelial transforming gene 1 in adenocarcinoma of the oesophagogastric junction.
24196235 2014 Expression and function of NET-1 in human skin squamous cell carcinoma.
23945136 2013 Expression of neuroepithelial transforming gene 1 is enhanced in oesophageal cancer and mediates an invasive tumour cell phenotype.
23872233 2013 The relationship between the presence of ADHD and certain candidate gene polymorphisms in a Turkish sample.
23864709 2013 Rho GTPase-independent regulation of mitotic progression by the RhoGEF Net1.
23689132 2013 Regulation of focal adhesion kinase activation, breast cancer cell motility, and amoeboid invasion by the RhoA guanine nucleotide exchange factor Net1.
23636606 2013 Inhibition of hepatocellular carcinoma growth and angiogenesis by dual silencing of NET-1 and VEGF.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23184663 2013 Rac1 controls the subcellular localization of the Rho guanine nucleotide exchange factor Net1A to regulate focal adhesion formation and cell spreading.
22927407 2012 Net -1 frameshifting on a noncanonical sequence in a herpes simplex virus drug-resistant mutant is stimulated by nonstop mRNA.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22343628 2012 Neuroepithelial transforming gene 1 (Net1) binds to caspase activation and recruitment domain (CARD)- and membrane-associated guanylate kinase-like domain-containing (CARMA) proteins and regulates nuclear factor ?B activation.
21390328 2011 The small GTPase RhoA localizes to the nucleus and is activated by Net1 and DNA damage signals.
21373644 2011 The nuclear guanine nucleotide exchange factors Ect2 and Net1 regulate RhoB-mediated cell death after DNA damage.
21284875 2011 A functional and transcriptomic analysis of NET1 bioactivity in gastric cancer.
20547485 2010 Smad3 regulates Rho signaling via NET1 in the transforming growth factor-beta-induced epithelial-mesenchymal transition of human retinal pigment epithelial cells.
20078975 2009 [Functions of NET-1 gene in skin squamous cell carcinoma cell line (A431): a siRNA study].
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19586902 2009 Interaction of the RhoA exchange factor Net1 with discs large homolog 1 protects it from proteasome-mediated degradation and potentiates Net1 activity.
19124484 2009 Coexpression of alpha6beta4 integrin and guanine nucleotide exchange factor Net1 identifies node-positive breast cancer patients at high risk for distant metastasis.
18827818 2008 NET1-mediated RhoA activation facilitates lysophosphatidic acid-induced cell migration and invasion in gastric cancer.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18509476 2008 A bacterial cytotoxin identifies the RhoA exchange factor Net1 as a key effector in the response to DNA damage.
18478931 2007 [Expression and significance of NET-1 protein in hepatocellular carcinoma].
18214716 2008 Expression and clinical significance of NET-1 and PCNA in hepatocellular carcinoma.
17938206 2007 The nuclear RhoA exchange factor Net1 interacts with proteins of the Dlg family, affects their localization, and influences their tumor suppressor activity.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16552434 2006 Net1 and Myeov: computationally identified mediators of gastric cancer.
16385451 2006 A scan of chromosome 10 identifies a novel locus showing strong association with late-onset Alzheimer disease.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15851553 2005 The lacrimal gland transcriptome is an unusually rich source of rare and poorly characterized gene transcripts.
15684429 2005 PAK1 negatively regulates the activity of the Rho exchange factor NET1.
15611121 2005 Characterization of the biochemical and transforming properties of the neuroepithelial transforming protein 1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11350080 2001 Identification of mNET1 as a candidate ligand for the first PDZ domain of MAGI-1.
11278519 2001 The activity of guanine exchange factor NET1 is essential for transforming growth factor-beta-mediated stress fiber formation.
8649828 1996 Isolation of a novel oncogene, NET1, from neuroepithelioma cells by expression cDNA cloning.