Property Summary

NCBI Gene PubMed Count 197
PubMed Score 2122.70
PubTator Score 416.12

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (28)

Gene RIF (154)

PMID Text
26600525 higher rates of nestin expression were observed in most embryonal Rhabdomyosarcoma specimens and low-grade tumors, in early stages of the disease, and among younger patients.
26421614 The stem cell marker nestin and the epithelial-mesenchymal transition marker periostin allow prognostic stratification among histologic variants of malignant pleural mesothelioma. Their expression level is influenced by neo-adjuvant chemotherapy.
26414809 Nestin expression was consistently found in endothelial cells of the schneiderian membrane.
26335012 Administration of nestin siRNA significantly decreased primary and metastatic tumor formation by human pancreatic cancer cells.
26261513 Our findings indicated that Nestin plays an essential role in colorectal cancer progression
26242334 Increased miR-21 and nestin mRNA levels were found in anaplastic meningiomas, in which recurrence is
25967234 High level of CD133 expression trends to correlate with a worse OS and PFS in glioma patients, especially WHO IV gliomas
25940879 Nestin has been shown to be expressed in transformed cells of various human malignancies, and a correlation between its expression and the clinical course of some diseases has been proved. [review]
25854362 High nestin expression is associated with gastric adenocarcinoma.
25843934 Results indicate that nestin plays an important role in the embryonic development of at least two mouse organs (heart and brain) through the regulation of cell proliferation
25839093 Nestin is expressed in acute leukemia and might be a useful immunohistochemical marker for identifying acute myeloid leukemia and acute lymphoblastic leukemia
25629269 Prolactin significantly increased the gene expression and protein levels of nestin in neuroblastoma SK-N-SH cells, while no significant changes were observed in U-87MG glioblastoma cells.
25605182 High nestin expression is associated with recurrence in bladder urothelial carcinoma.
25599268 There were significant increases in the percentage of ependymal cells that were nestin positive between controls and trauma cases
25527454 Data suggest that nhibition of nestin and heat shock protein HSPA8/HSC71 may be a useful molecular target in the treatment of glioblastomas.
25500739 Nestin-mediated cytoskeleton remodeling in endothelial cells occurs via filopodia formation along the cell edge.
25428542 human meninges intense nestin expression was detected as early as in the 9th week of embryonic development.
25400792 Case Report: undifferentiated colon carcinoma overexpressing nestin.
25376607 Results show that lower BAI1 expression correlates with poorer patient survival, and high Nestin expression is associated with an increased probability of metastases in breast cancer patients.
25371063 Nestin performs a dual role in ampullary adenocarcinoma, nestin enhances CDK5 function to suppress Rac1 and excessive nestin/CDK5 participates in multiple oncogenic pathways to promote cancer invasiveness.
25365206 Nestin depletion induces melanoma matrix metalloproteinases and invasion.
25339000 Elevated expression levels of nestin in the melanomas are associated with advanced disease, with more aggressive and metastatic skin tumors
25322343 Nestin expression profile in melanoma
25178519 It could be a clinically relevant marker associated with tumor invasiveness in cerebral astrocytomas.
25164879 Data suggest that nestin may serve as a promising tumor marker and as a potential therapeutic target amenable to tumor suppression and angiogenesis inhibition.
25120750 a high level of nestin was associated with poor progression-free survival in glioma patients with WHO grade II tumors
25118937 Ectopic expression of Nestin partially reverses the effects of miR-940 on cell proliferation, cell cycle and apoptosis.
25083869 Study shows that p53 restricts expression of the stem and progenitor-cell-associated protein nestin in an Sp1/3 transcription-factor-dependent manner and that Nestin is required for tumor initiation in vivo.
25056574 Our data indicates that Nestin positively regulates the proliferation, survival and invasiveness of breast CSC by enhancing Wnt/beta-catenin activation.
24785714 nestin expression is a novel independent prognostic indicator for patients with UCB
24755685 MMP-7 and nestin may be beneficial as markers, given their sensitivity to gastrointestinal stromal tumors.
24657437 MiR-432 regulates neuronal differentiation of human neuroblastoma cells and significantly represses NESTIN and MECP2 expression.
24610946 Results indicate that nestin regulates the localisation and functions of FAK and integrin. Because nestin has been shown to be prevalent in a number of cancers, our observations have ramifications for the roles of nestin in malignant transformation.
24519516 The results showed that high nestin expression is a strong adverse prognostic factor for total survival in patients with WHO grade II-III astrocytomas and oligoastrocytomas.
24503548 Our results demonstrated that urinary nestin could be a urinary biomarker for patients with acute kidney injury and its role in AKI might be related to the p53 signaling pathway.
24498263 Data indicate that nestin expression in non-small cell lung cancer (NSCLC) cells is associated with poor prognosis of patients and tumor cell proliferation pathway.
24481417 nestin correlates with the aggressiveness and stemness of lung adenocarcinoma.
24443256 the expression of nestin might play an important role in the prognosis of breast carcinoma, especially in the triple-negative subgroups.
24283983 Nestin is significantly higher in lung adenocarcinoma patients especially with advanced grade and stage.
24254558 We propose that nestin expression might contribute to the initiation, promotion, and progression of serous ovarian carcinoma; nestin expression is associated with poor chemoresponse.
24147430 nestin could be a very useful abluminal cell marker for the diagnosis of salivary gland tumors.
24030749 increased nestin expression was associated with aggressive melanoma features, with independent prognostic impact on multivariate survival analysis
24008823 These results demonstrate for the first time the expression of nestin in the pterygium vasculature and indicate that this protein may play a central role in the angiogenic response
23962157 High inmunohistochemical nestin expression appears to be associated with deeper invasion in DFSP.
23776077 PDGFRalpha CD51 cells in fetal bone marrow represent a small subset of CD146 cells expressing Nestin and enriched for mesenchymal stem cell and hematopoietic stem cell niche activities.
23757003 Data indicate that the only constantly present diagnostic marker observed was S100 protein and, in lesser extent, also nestin.
23706418 Nestin was detected in SCLC tumor cells and tumor vessels in all clinical tumor specimens.
23552743 These findings uncovered a novel role of nestin in regulating TGF-beta1-induced epithelial-mesenchymal transition.
23417116 Further studies are required to elucidate the regulatory mechanisms of nestin expression and to examine the possibility of nestin-targeted therapy for malignant melanomas.
23291835 Data indicate that the nestin and vimentin dots were random distributed within filamentous lines tens of nanometers to one hundred nanometers thick.
23131160 Data suggest that adult cutaneous sensory Meissner and Pacinian corpuscles contain small population of Schwann-related cells (vimentin+) which (on basis of their content of nestin and S100 proteins) can be potential neural stem cells.
23072594 These results suggest the presence in melanoma of growth mechanisms involving nestin, vimentin, and the glucocorticoid receptor may help in understanding tumour biology to provide a molecular basis for clinical therapies.
22999866 Although transgenic nestin-GFP-expressing progenitor cells share morphological and molecular markers with NG2-glia, they do not express other pericyte markers nor do they differentiate into the muscle lineage.
22993065 Tubule repair that occurs during the recovery process following nephrectomy may involve TGF-beta1-induced nestin expression in immature renal proximal tubule cells and the promotion of renal cell migration.
22985576 MAP-2 and nestin participate in the regulation of the development of gastric tissues in human embryos.
22899289 This study provides evidence that nestin and SOX2 can effectively differentiate nodal melanocytic nevi from metastatic melanomas
22886682 In human pituitary tumors there was a predominance of small capillaries in correlation with increased expression of the progenitor marker nestin
22718289 Studies suggest that nestin may modulate the invasion and metastasis of nestin-positive progenitor cells during pancreatic ductal adenocarcinoma (PDAC) development and may serve as a novel target for suppressing invasion and metastasis in PDAC.
22649953 Nestin expression was higher in tumor tissues of renal cell carcinoma, than normal tissues (p < 0.05). Nestin expression was inversely related with tumor stage (p < 0.05) but there was no relation with Fuhrman grade.
22580387 Nestin was not localized in the squamous epithelium in normal cervical tissues, but it was weakly expressed in the basal squamous epithelium in cervical intraepithelial neoplasia
22572237 The present study suggests that nestin expression seems to be a prognostic indicator of a poorer survival probability in patients with resected LCNEC, although its prognostic significance still requires confirmation with larger patient populations.
22568867 In summary, our data implicate nestin as a useful novel marker for intracranial ependymoma risk stratification easily implementable in routine diagnostics.
22395498 nestin and caveolin-1 could have a role in GISTs, together with CD117 and CD34
22350668 Our results suggest that: (1) nestin is a useful marker for diagnosis of high-grade gliomas, (2) nestin is helpful in diagnosis of schwannomas, and (3) nestin expression is related to poor prognosis in high-grade gliomas.
22344865 Despite significantly shorter survival rates observed in patients with high levels of nestin expression assessed by immunofluorescence, nestin does not seem to represent a powerful prognostic marker that would be superior to conventional methods.
22297445 Nestin was detectable in tumoral cells and in endothelial cells of blood microvessels, and it is significantly expressed in triple-negative and in inflammatory breast cancer (IBC) subgroups of T4 breast tumours
22296500 High expression level of nestin is associated with chemotherapy-resistance in serous ovarian cancer.
22246533 Nestin is a potential novel therapeutic target in pancreatic cancers to inhibit tumor angiogenesis.
22207173 Oct-4 and Nestin were important regulators of the development of breast cancer.
22187705 An intimate link of nestin to a biological process of pancreatic cancer was confirmed. The expression of nestin did not prove to be a valuable prognostic factor.
22178090 Both CD133-positive and nestin-positive blood vessels have an important role in maintaining the structure of the glioma stem cell niche.
22156015 The co-expression of CD133 and nestin as well as results of the functional assays suggest a possible presence of cancer cells with a stem-like phenotype in rhabdomyosarcoma.
22135720 nestin and CD44 are significantly expressed in a subset of gastric adenocarcinoma
22113177 In epithelioid mesotheliomas, 13% of cells expressed nestin, 39% EMA and 7% mesothelin
21985235 Smooth muscle cells expressing nestin and Nkx6.1 are the main cell population derived from culturing human spinal cord cells in adherent conditions with serum.
21915031 We sought to determine if ezrin, KBA.62, p-Akt, CD166, and nestin, may be helpful in distinguishing melanoma from nevi and atypical melanocytic lesions
21672338 The presence of nestin protein parallels the biological behaviour of osteochondromas and is restricted to prehypertrophic and hypertrophic chondrocytes.
21527990 eGFP-positive cells in the subventricular zone express multiple phenotype markers and neuroblast-specific molecules suggesting the transgene is expressed through the lineage.
21524985 These results suggest that the nestin-positive cells play an important role not only in the hair follicle pluripotent stem cells but also in the dermal papilla in the regenerating hair follicle.
21503585 nestin plays important roles in cell growth, migration, invasion and adhesion to extra-cellular matrices in glioma cells
21490921 Data demonstrate that Class III cells are mature neurons in the adult brain that express nestin.
21440298 High nestin expression is associated with plasma cells of multiple myeloma.
21340483 we perform the first study of the intracellular distribution of nestin in cell lines derived from neurogenic tumors
21323603 Nestin and Sox-2 immunoreactivity was significantly associated with astrocytic glioma tumor cell proliferation and nestin expression was independently associated with poor patient survival.
21276080 Nestin-positive cells are found as frequently as balloon cells and are associated with abnormal reconstitution of the cortex in epileptic patients.
21251041 Expression of embryonic stem cell markers SOX2 and nestin in dermatofibrosarcoma protuberans and dermatofibroma.
21151388 Nestin may be the most specific marker for stemness in anaplastic thyroid carcinoma by immunohistochemial staining.
20943257 The distribution pattern of nestin in normal meningeal and tumor cells indicates that nestin might characterize immature cells.
20700038 Report expression of stem-cell markers cytokeratin 15 and nestin in primary adnexal neoplasms.
20669222 nestin plays a crucial role in development of glioblastoma and may potentially be targeted for treatment of the disease.
20649878 Nestin expression is associated with tubulointerstitial injury and predicts renal prognosis in IgA nephropathy.
20536663 marker of HMB-45-negative melanoma cells in the dermal parts of patients with nodular melanoma
20520523 We found a significant population of nestin-positive progenitor cells in neurofibromas from patients with neurofibromatosis type 1.
20518888 Nestin-positive myofibroblast may represent a relatively immature subpopulation of cells with multipotentiality.
20426902 Compared with the controls, the number of nestin-positive cells is increased in the subgranular zone of the hippocampus dentate gyrus and in the subventricular zone following cerebral ischemia.
20337823 In all 15 trichoblastomas, the stromal cells expressed nestin with variable positive reactions, except for superficial trichoblastomas within nevus sebaceous lesions, in which stromal cells were constantly positive for nestin
20132963 nestin expressed in most tumor cells of non-small cell lung cancer tissue and had a direct linkage to lymph node metastasis and tumor-induced lymphangiogenesis, independent of COX-2 signal pathway.
20044038 We suggest that some nestin-positive cells might be capable to differentiate into neurons during the earliest stages of development
20017104 These observations emphasize an essential role of nestin for the process of regeneration, and also highlight this factor as a candidate marker for sustentacular cells in the human olfactory epithelium.
19956860 nestin has a role in progression of human melanoma
19864043 nestin functions as a stem cell marker of the follicular mesenchyme and has a major regulatory role in dermal homeostasis, cutaneous neovasculogenesis, and tumor stroma development
19845757 nestin was significantly associated with presence of ulceration in primary tumors in melanoma.
19704967 Nestin is present in podocytes of the renal corpuscle in rats and humans. Specific differences manifested in more intensive and widespread expression of nestin by endothelial cells of blood vessels in human kidney.
19578047 Our results support the combined role of WT1 and nestin in glial tumorigenesis and progression.
19562035 expression of nestin is a major determinant in suppression of anti-proliferative activity of GR in undifferentiated tissue and facilitates activation of this growth control in a precise tissue and differentiation dependent manner
19554024 nestin expression at the gene and protein levels in human scalp skin is restricted to the periappendage mesenchyme and can be stimulated by leptin
19473053 Increased expression of nastin is associated with astrocytoma pathogenesis and progression.
19417621 marker of Wilms tumor in or around the kidney
19294612 Expression of nestin mRNA could be detected in adrenocortical tumors, independently of their grade of dedifferentiation.
19268442 nestin mRNA is a differentiation marker, and its expression does not relate to malignant characteristics in thyroid tumors
19170896 Findings indicate that transplantation of embryonic neural stem cells into adult rat peri-infarction zone may be performed as early as 24 hours after cerebral ischemia.
19012049 candidate for stem cell marker and renewal factor in nasal mucosa, may contribute to tissue homeostasis and differentiation in the epithelium and submucosal glands of normal nasal mucosa, and may play a role in proliferation of nasal polyps
18998057 higher expression of nestin in the non-specific form of Dysembryoplastic neuroepithelial tumors suggests that the non-specific form has an earlier developmental origin than the simple or complex forms.
18925963 expression is detected in osteosarcomas
18923447 SOX9 and SOX10 but not BRN2 seem to be required for nestin expression in human melanoma.
18799194 Nestin expression in pancreatic cancer cells may contribute to nerve and stromal invasion in this malignancy
18724228 Cyclosporin A induced renal injury recruits nestin-expressing cells to injured areas.
18724036 Nestin gene variants are associated with early-onset CHD.
18724036 Observational study of gene-disease association. (HuGE Navigator)
18618166 Dental follicle cells expressed the stem cell marker nestin in both serum-free and serum-containing cell culture media.
18546018 Nestin plays a crucial role in remodeling the cytoskeleton of cells in the human postinfarcted myocardium.
18265627 Nestin is expressed in proliferating and metabolically active cells, such as endothelium, independent of developmental and neoplastic processes.
17984177 enhanced expression of nestin in the injured myocardium might reflect spontaneous regenerative processes supposedly based on the differentiation of resident cardiac stem cells into diverse cardiac cell types.
17909025 Results specify a function for Nestin in cell motility and identify a novel pathway for prostate cancer metastasis.
17784840 The extent of nestin-positive neuronal cells correlated with the appearance of tyrosine hydroxylase positive neurons.
17784648 Nestin is expressed in podocytes of mature human glomerular tissues in quiescent states.
17652163 The nestin(-) vimentin(+) fibroblasts may represent a novel type of multipotent adult stem cells in human dermis.
17537965 Transgenic mice in which the nestin neural enhancer drives expression of a green fluorescent protein reporter show that the regulation in Schwann cells is transcriptional.
17300669 Nestin is more sensitive for malignant peripheral nerve sheath tumor (MPNST) than other neural markers, and immunostains for nestin in combination with other markers could be useful in the diagnosis of MPNST.
17273760 nestin has a role in neovasculaturization in colorectal cancer
17255215 The expression of nestin in the podocytes of normal and diseased kidneys of adolesscent and adult patients is reported.
17210924 Nestin is expressed in the human kidney from the first steps of glomerulogenesis within podocytes, mesangial, and endothelial cells.
17036052 nestin is a survival determinant whose action is based upon a novel mode of Cdk5 regulation, affecting the targeting, activity, and turnover of the Cdk5/p35 signaling complex
16874866 The putative pancreatic stem cells expressed pdx-1 and nestin.
16826367 In a series of 40 surgical specimens, including gliomas, vascular malformations, abscesses and angiomas, nestin was poorly expressed in mature astrocytes and more expressed in developing reactive astrocytes, mainly in the cytoplasm.
16736556 Nestin-positive pancrease stem cells are in the stroma of human embryonic pancrease.
16713999 cultured pancreatic islets contain nestin and Isl-1 positive mesenchymal stem cells with multipotential developmental capacity
16616189 Purkinje cells were immunoreactive with nestin regardless of the severity of degenerative cerebellar cortex.
16538520 Nestin expression in adenomas cannot be viewed as a biologically relevant marker of cell proliferation and as a prognostic indicator in pituitary neoplasms.
16487364 Moderate to strong expression of nestin was observed in all tumors.
16275024 These results show that the pattern of nestin expression is related to the differentiation of epidermal stem cells.
16186627 Data evaluate and compare the bcl2, bax, and nestin patterns in the frontal cortices of Alzheimer and multiple-infarct dementia patients, and in normal aging.
16136494 Nestin is constantly expressed in situ in the cortex of normal human adrenal glands; a positive nestin immunoreaction could be useful in differential diagnosis of clear cell tumors in adrenal glands.
15684833 nestin expression is recognized under all conditions of vascular development
15526158 nestin has a role in multi-potentiality and regenerative potential [review]
15502861 Nestin expression in tumor endothelium is enhanced by the first intron.
15176089 In transgenic mice, nestin transgene expression in the olfactory bulb is limited to periglomerular neurons and is absent from granule cells, suggesting that this nestin promoter construct differentiates between the two interneuronal populations.
15117961 nestin may be one mediator of N-myc-associated tumor aggressiveness of human neuroblastoma
15088413 detection of nestin-positive keratinocytes in the basal layer of cultured epidermis
14625035 Demonstration of strong expression of nestin in Purkinje cells in pathologically advanced Creutzfeldt-Jakob disease correlates with the process that Purkinje cells undergo to promote survival.
12786777 Nestin-immunoreactive cells colocalized with vimentin throughout the retina. Colocalized with mitotic Ki67 immunoreactive cells.
12187925 Beta-cell differentiation during human development does not rely on nestin-positive precursors
12172785 The tissue distribution of nestin has been studied in the muscularis propria of normal gastrointestinal autopsy material.
12101039 Nestin-containing neurons occurred in hippocampus, septum, diagonal band, amygdala and basal nucleus of Meynert. Nestin-containing astrocytes occurred in the subependymal zone and dentate gyrus.

AA Sequence

MEGCMGEESFQMWELNRRLEAYLARVKALEEQNELLSAELGGLRAQSADTSWRAHADDELAALRALVDQR      1 - 70
WREKHAAEVARDNLAEELEGVAGRCQQLRLARERTTEEVARNRRAVEAEKCARAWLSSQVAELERELEAL     71 - 140
RVAHEEERVGLNAQAACAPRCPAPPRGPPAPAPEVEELARRLGEAWRGAVRGYQERVAHMETSLGQARER    141 - 210
LGRAVQGAREGRLELQQLQAERGGLLERRAALEQRLEGRWQERLRATEKFQLAVEALEQEKQGLQSQIAQ    211 - 280
VLEGRQQLAHLKMSLSLEVATYRTLLEAENSRLQTPGGGSKTSLSFQDPKLELQFPRTPEGRRLGSLLPV    281 - 350
LSPTSLPSPLPATLETPVPAFLKNQEFLQARTPTLASTPIPPTPQAPSPAVDAEIRAQDAPLSLLQTQGG    351 - 420
RKQAPEPLRAEARVAIPASVLPGPEEPGGQRQEASTGQSPEDHASLAPPLSPDHSSLEAKDGESGGSRVF    421 - 490
SICRGEGEGQIWGLVEKETAIEGKVVSSLQQEIWEEEDLNRKEIQDSQVPLEKETLKSLGEEIQESLKTL    491 - 560
ENQSHETLERENQECPRSLEEDLETLKSLEKENKELLKDVEVVRPLEKEAVGQLKPTGKEDTQTLQSLQK    561 - 630
ENQELMKSLEGNLETFLFPGTENQELVSSLQENLESLTALEKENQEPLRSPEVGDEEALRPLTKENQEPL    631 - 700
RSLEDENKEAFRSLEKENQEPLKTLEEEDQSIVRPLETENHKSLRSLEEQDQETLRTLEKETQQRRRSLG    701 - 770
EQDQMTLRPPEKVDLEPLKSLDQEIARPLENENQEFLKSLKEESVEAVKSLETEILESLKSAGQENLETL    771 - 840
KSPETQAPLWTPEEINQGAMNPLEKEIQEPLESVEVNQETFRLLEEENQESLRSLGAWNLENLRSPEEVD    841 - 910
KESQRNLEEEENLGKGEYQESLRSLEEEGQELPQSADVQRWEDTVEKDQELAQESPPGMAGVENEDEAEL    911 - 980
NLREQDGFTGKEEVVEQGELNATEEVWIPGEGHPESPEPKEQRGLVEGASVKGGAEGLQDPEGQSQQVGA    981 - 1050
PGLQAPQGLPEAIEPLVEDDVAPGGDQASPEVMLGSEPAMGESAAGAEPGPGQGVGGLGDPGHLTREEVM   1051 - 1120
EPPLEEESLEAKRVQGLEGPRKDLEEAGGLGTEFSELPGKSRDPWEPPREGREESEAEAPRGAEEAFPAE   1121 - 1190
TLGHTGSDAPSPWPLGSEEAEEDVPPVLVSPSPTYTPILEDAPGPQPQAEGSQEASWGVQGRAEALGKVE   1191 - 1260
SEQEELGSGEIPEGPQEEGEESREESEEDELGETLPDSTPLGFYLRSPTSPRWDPTGEQRPPPQGETGKE   1261 - 1330
GWDPAVLASEGLEAPPSEKEEGEEGEEECGRDSDLSEEFEDLGTEAPFLPGVPGEVAEPLGQVPQLLLDP   1331 - 1400
AAWDRDGESDGFADEEESGEEGEEDQEEGREPGAGRWGPGSSVGSLQALSSSQRGEFLESDSVSVSVPWD   1401 - 1470
DSLRGAVAGAPKTALETESQDSAEPSGSEEESDPVSLEREDKVPGPLEIPSGMEDAGPGADIIGVNGQGP   1471 - 1540
NLEGKSQHVNGGVMNGLEQSEEVGQGMPLVSEGDRGSPFQEEEGSALKTSWAGAPVHLGQGQFLKFTQRE   1541 - 1610
GDRESWSSGED                                                              1611 - 1621
//

Text Mined References (209)

PMID Year Title
26600525 2015 Immunohistochemical expression of nestin in rhabdomyosarcoma: implications for clinicopathology and patient outcome.
26421614 2015 Expression of the Stem Cell Factor Nestin in Malignant Pleural Mesothelioma Is Associated with Poor Prognosis.
26414809 2015 Regenerative potential of human schneiderian membrane: progenitor cells and epithelial-mesenchymal transition.
26335012 2016 Systemic Administration of Small Interfering RNA Targeting Human Nestin Inhibits Pancreatic Cancer Cell Proliferation and Metastasis.
26261513 2015 Knockdown of Nestin inhibits proliferation and migration of colorectal cancer cells.
26242334 2015 Expression of Stem Cell Marker Nestin and MicroRNA-21 in Meningiomas.
25967234 2015 Do relevant markers of cancer stem cells CD133 and Nestin indicate a poor prognosis in glioma patients? A systematic review and meta-analysis.
25940879 2015 Nestin as a marker of cancer stem cells.
25854362 2015 Correlation of overexpression of nestin with expression of epithelial-mesenchymal transition-related proteins in gastric adenocarcinoma.
25843934 2015 Nestin overexpression promotes the embryonic development of heart and brain through the regulation of cell proliferation.
25839093 2015 Distribution of the cytoskeletal protein, Nestin, in acute leukemia.
25629269 2014 Prolactin increases expression of cytoskeletal proteins in SK-N-SH cells.
25605182 2014 Prognostic significance of Nestin expression in pT1 high- grade bladder urothelial carcinoma patients treated with intravesical BCG.
25599268 2015 Nestin-Positive Ependymal Cells Are Increased in the Human Spinal Cord after Traumatic Central Nervous System Injury.
25527454 2015 Inhibition of nestin suppresses stem cell phenotype of glioblastomas through the alteration of post-translational modification of heat shock protein HSPA8/HSC71.
25500739 2015 Nestin-mediated cytoskeletal remodeling in endothelial cells: novel mechanistic insight into VEGF-induced cell migration in angiogenesis.
25428542 2014 Intermediate filament protein nestin is expressed in developing meninges.
25400792 2014 Granulocyte colony-stimulating factor-producing undifferentiated carcinoma of the colon mimicking a pulmonary giant cell carcinoma: a case showing overexpression of CD44 along with highly proliferating nestin-positive tumor vessels.
25376607 2015 Changes in BAI1 and nestin expression are prognostic indicators for survival and metastases in breast cancer and provide opportunities for dual targeted therapies.
25371063 2015 Nestin predicts a favorable prognosis in early ampullary adenocarcinoma and functions as a promoter of metastasis in advanced cancer.
25365206 2014 Nestin depletion induces melanoma matrix metalloproteinases and invasion.
25339000 2014 Co-expression of putative cancer stem cell markers, CD133 and Nestin, in skin tumors.
25322343 2014 Large-scale proteomic characterization of melanoma expressed proteins reveals nestin and vimentin as biomarkers that can potentially distinguish melanoma subtypes.
25178519 2015 Immunohistochemical analysis of GFAP-? and nestin in cerebral astrocytomas.
25164879 2014 Nestin involvement in tissue injury and cancer--a potential tumor marker?
25120750 2014 Clinical value of CD133 and nestin in patients with glioma: a population-based study.
25118937 2014 Depletion of intermediate filament protein Nestin, a target of microRNA-940, suppresses tumorigenesis by inducing spontaneous DNA damage accumulation in human nasopharyngeal carcinoma.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
25083869 2014 p53-dependent Nestin regulation links tumor suppression to cellular plasticity in liver cancer.
25056574 2014 Nestin positively regulates the Wnt/?-catenin pathway and the proliferation, survival and invasiveness of breast cancer stem cells.
24785714 2014 Nestin is an independent predictor of cancer-specific survival after radical cystectomy in patients with urothelial carcinoma of the bladder.
24755685 2014 The diagnostic importance of matrix metalloproteinase-7 and nestin in gastrointestinal stromal tumors.
24657437 2014 MicroRNA-432 contributes to dopamine cocktail and retinoic acid induced differentiation of human neuroblastoma cells by targeting NESTIN and RCOR1 genes.
24610946 2014 Nestin regulates prostate cancer cell invasion by influencing the localisation and functions of FAK and integrins.
24519516 2014 High expression of the stem cell marker nestin is an adverse prognostic factor in WHO grade II-III astrocytomas and oligoastrocytomas.
24503548 2014 Identification of nestin as a urinary biomarker for acute kidney injury.
24498263 2014 Role of the stem cell-associated intermediate filament nestin in malignant proliferation of non-small cell lung cancer.
24481417 2014 Nestin regulates proliferation, migration, invasion and stemness of lung adenocarcinoma.
24443256 2014 Nestin: predicting specific survival factors for breast cancer.
24283983 2014 Evaluation of nestin in lung adenocarcinoma: relation to VEGF and Bcl-2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24254558 2013 Expression of nestin in ovarian serous cancer and its clinicopathologic significance.
24147430 2013 Nestin is a wide-spectrum abluminal cell marker of salivary gland tumors.
24030749 2014 Nestin expression is associated with aggressive cutaneous melanoma of the nodular type.
24008823 2014 Nestin expression in pterygia: potential role in angiogenesis.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23962157 2013 High immunohistochemical nestin expression is associated with greater depth of infiltration in dermatofibrosarcoma protuberans: a study of 71 cases.
23776077 2013 PDGFR? and CD51 mark human nestin+ sphere-forming mesenchymal stem cells capable of hematopoietic progenitor cell expansion.
23757003 2013 Cultivation-dependent plasticity of melanoma phenotype.
23706418 2013 Involvement of intermediate filament nestin in cell growth of small-cell lung cancer.
23552743 2013 Stem cell marker nestin is critical for TGF-?1-mediated tumor progression in pancreatic cancer.
23417116 2013 Nestin is highly expressed in advanced-stage melanomas and neurotized nevi.
23291835 2012 Ultra-high-resolution images of nestin and vimentin in pancreatic carcinoma cells using 2 novel microscopy systems.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23131160 2012 Evidence of nestin-positive cells in the human cutaneus Meissner and Pacinian corpuscles.
23072594 2013 Nestin and vimentin colocalization affects the subcellular location of glucocorticoid receptor in cutaneous melanoma.
22999866 2013 Skeletal muscle neural progenitor cells exhibit properties of NG2-glia.
22993065 2012 Upregulation of nestin in proximal tubules may participate in cell migration during renal repair.
22985576 2012 [Microtubule-associated protein 2 and nestin expressions in human embryonic and fetal gastric tissues].
22899289 2013 Diagnostic utility of neural stem and progenitor cell markers nestin and SOX2 in distinguishing nodal melanocytic nevi from metastatic melanomas.
22886682 2013 Enhanced nestin expression and small blood vessels in human pituitary adenomas.
22718289 2012 Nestin and other putative cancer stem cell markers in pancreatic cancer.
22649953 2012 Stem cell markers aldehyde dehydrogenase type 1 and nestin expressions in renal cell cancer.
22580387 2012 Expression and role of nestin in human cervical intraepithelial neoplasia and cervical cancer.
22572237 2012 Prognostic impact of nestin expression in resected large cell neuroendocrine carcinoma of the lung.
22568867 2012 Nestin expression identifies ependymoma patients with poor outcome.
22395498 2012 Nestin and caveolin-1 in the diagnosis of GISTs.
22350668 2012 Nestin expression in brain tumors: its utility for pathological diagnosis and correlation with the prognosis of high-grade gliomas.
22344865 2012 Nestin expression in high-grade osteosarcomas and its clinical significance.
22297445 2011 Nestin expression associates with poor prognosis and triple negative phenotype in locally advanced (T4) breast cancer.
22296500 2012 Expression of putative stem marker nestin and CD133 in advanced serous ovarian cancer.
22246533 2012 Nestin as a novel therapeutic target for pancreatic cancer via tumor angiogenesis.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22207173 2012 Co-expression of Oct-4 and Nestin in human breast cancers.
22187705 2011 Clinicopathological correlations of nestin expression in surgically resectable pancreatic cancer including an analysis of perineural invasion.
22178090 2012 The pathological characteristics of glioma stem cell niches.
22156015 2011 CD133 expression and identification of CD133/nestin positive cells in rhabdomyosarcomas and rhabdomyosarcoma cell lines.
22135720 2011 Clinicopathologic significance of putative stem cell markers, CD44 and nestin, in gastric adenocarcinoma.
22113177 2012 Immunolocalization of nestin, mesothelin and epithelial membrane antigen (EMA) in developing and adult serous membranes and mesotheliomas.
21985235 2011 Isolation of mineralizing Nestin+ Nkx6.1+ vascular muscular cells from the adult human spinal cord.
21915031 2011 Tissue microarray analysis of ezrin, KBA.62, CD166, nestin, and p-Akt in melanoma versus banal and atypical nevi, and nonmelanocytic lesions.
21672338 2011 Expression of the stem cell marker nestin in pre/hypertrophic chondrocytes in osteochondroma.
21527990 2010 Nestin reporter transgene labels multiple central nervous system precursor cells.
21524985 Hair follicle stem cell marker nestin expression in regenerating hair follicles of patients with alopecia areata.
21503585 2011 Neuroepithelial stem cell marker nestin regulates the migration, invasion and growth of human gliomas.
21490921 2011 Expression of nestin by neural cells in the adult rat and human brain.
21440298 2011 Stem cell marker nestin is expressed in plasma cells of multiple myeloma patients.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21340483 2011 Analysis of nuclear nestin localization in cell lines derived from neurogenic tumors.
21323603 2011 Association of stem cell-related markers and survival in astrocytic gliomas.
21276080 2011 An immunohistochemical finding in glioneuronal lesions associated with epilepsy: the appearance of nestin-positive, CD34-positive and tau-accumulating cells.
21269460 2011 Initial characterization of the human central proteome.
21251041 2011 Expression of embryonic stem cell markers SOX2 and nestin in dermatofibrosarcoma protuberans and dermatofibroma.
21185309 2011 Ubiquitin is a novel substrate for human insulin-degrading enzyme.
21151388 2010 Immunohistochemical detection of epithelialmesenchymal transition associated with stemness phenotype in anaplastic thyroid carcinoma.
20943257 2011 Expression of nestin, mesothelin and epithelial membrane antigen (EMA) in developing and adult human meninges and meningiomas.
20700038 2010 Expression of stem-cell markers (cytokeratin 15 and nestin) in primary adnexal neoplasms-clues to etiopathogenesis.
20669222 2011 Inducible expression of stem cell associated intermediate filament nestin reveals an important role in glioblastoma carcinogenesis.
20649878 2010 Nestin is a novel marker for renal tubulointerstitial injury in immunoglobulin A nephropathy.
20536663 2010 Nestin is expressed in HMB-45 negative melanoma cells in dermal parts of nodular melanoma.
20520523 2010 Nestin-positive stem cells in neurofibromas from patients with neurofibromatosis type 1-tumorigenic or incidental?
20518888 2010 Heterogeneous expression of nestin in myofibroblasts of various human tissues.
20426902 2010 Expression of nestin and glial-derived neurotrophic factor in human endogenous neural stem cells following ischemia.
20337823 2010 Nestin expression in stromal cells of trichoblastoma and basal cell carcinoma.
20132963 2010 Expression of nestin in lymph node metastasis and lymphangiogenesis in non-small cell lung cancer patients.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20044038 Nestin expression in glial and neuronal progenitors of the developing human spinal ganglia.
20017104 2010 Expression and distribution of the intermediate filament protein nestin and other stem cell related molecules in the human olfactory epithelium.
19956860 2010 The stem cell marker nestin predicts poor prognosis in human melanoma.
19864043 2010 Spatiotemporal expression pattern of neuroepithelial stem cell marker nestin suggests a role in dermal homeostasis, neovasculogenesis, and tumor stroma development: a study on embryonic and adult human skin.
19845757 2010 Nestin and SOX9 and SOX10 transcription factors are coexpressed in melanoma.
19704967 2009 Expression of neural stem cell marker nestin in the kidney of rats and humans.
19578047 2010 High-grade astrocytomas show increased Nestin and Wilms's tumor gene (WT1) protein expression.
19562035 2009 Nestin modulates glucocorticoid receptor function by cytoplasmic anchoring.
19554024 2009 Nestin in human skin: exclusive expression in intramesenchymal skin compartments and regulation by leptin.
19473053 2009 Analysis of VEGF, Flt-1, Flk-1, nestin and MMP-9 in relation to astrocytoma pathogenesis and progression.
19445653 2009 Proliferation and multi-differentiation potentials of human mesenchymal stem cells on thermoresponsive PDMS surfaces grafted with PNIPAAm.
19417621 2009 Diagnostic utility of nestin expression in pediatric tumors in the region of the kidney.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19384922 2009 ABCB1 is predominantly expressed in human fetal neural stem/progenitor cells at an early development stage.
19294612 2009 Nestin as a marker in the classification of adrenocortical tumors.
19268442 2009 Expression of nestin mRNA is a differentiation marker in thyroid tumors.
19170896 2009 Transplanted human embryonic neural stem cells survive, migrate, differentiate and increase endogenous nestin expression in adult rat cortical peri-infarction zone.
19012049 2009 Expression and distribution patterns of the stem cell marker, nestin, and the stem cell renewal factor, BMI-1, in normal human nasal mucosa and nasal polyps.
18998057 2009 Different pattern of expression of nestin in the non-specific form of dysembryoplastic neuroepithelial tumors compared to the simple and complex forms.
18925963 2008 Nestin expression in osteosarcomas and derivation of nestin/CD133 positive osteosarcoma cell lines.
18923447 2009 SOX9 and SOX10 but not BRN2 are required for nestin expression in human melanoma cells.
18799194 2009 Nestin expression correlates with nerve and retroperitoneal tissue invasion in pancreatic cancer.
18724228 2008 Infiltration of nestin-expressing cells in interstitial fibrosis in chronic cyclosporine nephropathy.
18724036 2008 Variants in the nestin gene and coronary heart disease.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18618166 2008 Gene expression of nestin, collagen type I and type III in human dental follicle cells after cultivation in serum-free medium.
18546018 2008 Re-expression of nestin in the myocardium of postinfarcted patients.
18318008 2008 Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.
18265627 2007 Nestin expression in neoplastic, fetal, and adult pancreatic endocrine cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17984177 2008 Up-regulation of nestin in the infarcted myocardium potentially indicates differentiation of resident cardiac stem cells into various lineages including cardiomyocytes.
17909025 2007 Roles for the stem cell associated intermediate filament Nestin in prostate cancer migration and metastasis.
17784840 2007 Neurospheres derived from human embryoid bodies treated with retinoic Acid show an increase in nestin and ngn2 expression that correlates with the proportion of tyrosine hydroxylase-positive cells.
17784648 Expression of nestin in rat and human glomerular podocytes.
17652163 2007 Clonal analysis of nestin(-) vimentin(+) multipotent fibroblasts isolated from human dermis.
17537965 2007 Regulation of the intermediate filament protein nestin at rodent neuromuscular junctions by innervation and activity.
17300669 2007 Nestin expression as a new marker in malignant peripheral nerve sheath tumors.
17273760 2007 Identification of neovasculature using nestin in colorectal cancer.
17255215 2007 Expression of nestin in the podocytes of normal and diseased human kidneys.
17210924 2007 Nestin expression in adult and developing human kidney.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17036052 2006 A nestin scaffold links Cdk5/p35 signaling to oxidant-induced cell death.
16874866 2006 Characterization of pancreatic stem cells derived from adult human pancreas ducts by fluorescence activated cell sorting.
16826367 2006 Nestin expression in reactive astrocytes of human pathology.
16736556 2005 [Expression of Nestin, CK19, insulin, glucagon and somatostatin in embryonic pancreas].
16713999 2006 Multipotential nestin and Isl-1 positive mesenchymal stem cells isolated from human pancreatic islets.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16616189 2006 Nestin immunoreactivity of Purkinje cells in Creutzfeldt-Jakob disease.
16538520 2006 Immunohistochemical expression of nestin in the non-tumorous hypophysis and in pituitary neoplasms.
16487364 2006 Granular cell tumours of the gastrointestinal tract: expression of nestin and clinicopathological evaluation of 11 patients.
16275024 2006 Patterns of nestin expression in human skin.
16186627 2005 bcl2, bax, and nestin in the brains of patients with neurodegeneration and those of normal aging.
16136494 2005 Nestin expression in normal adrenal gland and adrenocortical tumors.
15684833 2004 Nestin expression by newly formed human blood vessels.
15526158 2004 Nestin expression--a property of multi-lineage progenitor cells?
15502861 2004 Angiogenic endothelium-specific nestin expression is enhanced by the first intron of the nestin gene.
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15176089 2004 Nestin promoter/enhancer directs transgene expression to precursors of adult generated periglomerular neurons.
15127288 2004 Nestin, a neuroectodermal stem cell marker molecule, is expressed in Leydig cells of the human testis and in some specific cell types from human testicular tumours.
15117961 2004 Nestin is a potential mediator of malignancy in human neuroblastoma cells.
15088413 Nestin-positive cells of cultured basal layer of human epidermis.
15048922 2004 Do hematopoietic cells exposed to a neurogenic environment mimic properties of endogenous neural precursors?
14965830 2004 Expression of nestin, an intermediate filament protein, in human fetal hepatic stem cells.
14765974 2004 Heterogenous expression of nestin in human pancreatic tissue precludes its use as an islet precursor marker.
14757413 Tissue-specific muscle, neural and liver stem/progenitor cells reside in the bone marrow, respond to an SDF-1 gradient and are mobilized into peripheral blood during stress and tissue injury.
14743441 2004 Retinoic acid-mediated induction of neurons and glial cells from human umbilical cord-derived hematopoietic stem cells.
14648588 2003 Isolation and characterization of neural progenitor cells from post-mortem human cortex.
14625035 2003 Expression of nestin in Purkinje cells in patients with Creutzfeldt-Jakob disease.
14613807 2003 Purification of astrocytes from adult human optic nerve heads by immunopanning.
14514635 2003 Characterization and isolation of promoter-defined nestin-positive cells from the human fetal pancreas.
12971951 2003 Piezo-power microdissection of mature human dental tissue.
12966727 2003 [Allogenic transplantation studies on human fetal pancreatic nestin positive cells].
12966327 2003 Human neural stem cells are more sensitive than astrocytes to ethanol exposure.
12928287 2003 Nestin positive cells in adult human retina and in epiretinal membranes.
12880961 2003 Neuroblastoma oligo-capping cDNA project: toward the understanding of the genesis and biology of neuroblastoma.
12836073 2003 Intermediate filament nestin expressions in human cord blood monocytes (HCMNCs).
12832492 2003 Cdk5 regulates the organization of Nestin and its association with p35.
12816052 [Neural stem and progenitor cells of human embryos and fetuses as a basis of biomedical new technologies].
12786777 2003 Müller cells express the neuronal progenitor cell marker nestin in both differentiated and undifferentiated human foetal retina.
12754281 2003 Nestin is expressed in vascular endothelial cells in the adult human pancreas.
12751206 2003 [Isolation, culture and biological character studies on human fetal pancreatic nestin positive cells].
12724646 2003 Human corneal stem cells display functional neuronal properties.
12695551 2003 Expression of tubulin beta II in neural stem/progenitor cells and radial fibers during human fetal brain development.
12663072 2003 Gene expression analysis in cells of the dentine-pulp complex in healthy and carious teeth.
12662433 2003 Fetal human hematopoietic stem cells can differentiate sequentially into neural stem cells and then astrocytes in vitro.
12640742 2001 Molecular aspects of tooth pathogenesis and repair: in vivo and in vitro models.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12187925 2002 Beta-cell differentiation during human development does not rely on nestin-positive precursors: implications for stem cell-derived replacement therapy.
12172785 2002 Distribution of the intermediate filament nestin in the muscularis propria of the human gastrointestinal tract.
12101039 2002 Distribution of nestin immunoreactivity in the normal adult human forebrain.
12051722 2002 Neurogenic differentiation of murine and human adipose-derived stromal cells.
11947939 2002 Analysis of the temporal expression of nestin in human fetal brain derived neuronal and glial progenitor cells.
11278541 2001 Mitotic reorganization of the intermediate filament protein nestin involves phosphorylation by cdc2 kinase.
11161590 2001 Transplantation of clonal neural precursor cells derived from adult human brain establishes functional peripheral myelin in the rat spinal cord.
10931522 2000 Adult rat and human bone marrow stromal cells differentiate into neurons.
10915564 2000 Adult bone marrow stromal cells differentiate into neural cells in vitro.
10912785 2000 Human dentin production in vitro.
10686078 2000 Coexpression of nestin in neural and glial cells in the developing human CNS defined by a human-specific anti-nestin antibody.
10595912 1999 Synaptophysin: A novel marker for human and rat hepatic stellate cells.
9917366 1999 Heterogeneity of neural progenitor cells revealed by enhancers in the nestin gene.
9104587 1997 An evolutionarily conserved region in the second intron of the human nestin gene directs gene expression to CNS progenitor cells and to early neural crest cells.
4078630 1985 Identification of major cell classes in the developing mammalian nervous system.
1478958 1992 Characterization of the human nestin gene reveals a close evolutionary relationship to neurofilaments.