Property Summary

NCBI Gene PubMed Count 16
PubMed Score 23.51
PubTator Score 14.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytic glioma -2.700 3.1e-03
glioblastoma -3.000 3.6e-04
oligodendroglioma -2.400 8.8e-16
posterior fossa group A ependymoma -3.600 1.1e-09
atypical teratoid / rhabdoid tumor -1.600 2.3e-02
primitive neuroectodermal tumor -2.300 3.8e-02
Atopic dermatitis 1.600 1.9e-03
non-small cell lung cancer 1.519 4.3e-06
Common variable immunodeficiency -1.106 7.1e-03
intraductal papillary-mucinous adenoma (... -1.100 4.8e-03
lung cancer 2.600 2.5e-05
breast carcinoma 1.300 8.1e-03
interstitial cystitis -1.600 7.3e-05
pediatric high grade glioma -2.500 1.1e-04
pilocytic astrocytoma -1.300 7.9e-04
primary Sjogren syndrome 1.500 1.8e-02
sarcoidosis -1.700 2.6e-05
psoriasis 1.100 4.2e-03
Pick disease -1.800 1.3e-02
ovarian cancer -4.800 2.5e-16
head and neck cancer -1.900 2.8e-02

Gene RIF (4)

PMID Text
25760060 CSF NELL2 is a potential diagnostic biomarker for TBM.
25726761 CpG islands in the NELL1 and NELL2 promoters are hypermethylated in renal cell carcinoma.NELL1 and NELL2 protein expression is downregulated in clear cell renal carcinoma.
23829315 Cells overexpressing NELL2 increased their invasive ability and an enhancement of the effect was observed when NELL2 and E2F1 were coexpressed in MDA-MB231 cells.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLFQDTPRSIKAS      1 - 70
TATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSGHRNEVRLHYRSGSHRPHTEV     71 - 140
FPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPSTDLPLGTTFWLGQRNNAHGYFKGIMQDVQL    141 - 210
LVMPQGFIAQCPDLNRTCPTCNDFHGLVQKIMELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTT    211 - 280
YREFESWIDGCKNCTCLNGTIQCETLICPNPDCPLKSALAYVDGKCCKECKSICQFQGRTYFEGERNTVY    281 - 350
SSSGVCVLYECKDQTMKLVESSGCPALDCPESHQITLSHSCCKVCKGYDFCSERHNCMENSICRNLNDRA    351 - 420
VCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSCTEHDECITNQ    421 - 490
HNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRNGGACIAANVCACPQGFTGPSCETDIDECS    491 - 560
DGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESCEDIDECGTGRHSCANDTICFNLDGGYDCRC    561 - 630
PHGKNCTGDCIHDGKVKHNGQIWVLENDRCSVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQC    631 - 700
LHQNGETLYNSGDTWVQNCQQCRCLQGEVDCWPLPCPDVECEFSILPENECCPRCVTDPCQADTIRNDIT    701 - 770
KTCLDEMNVVRFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL                            771 - 816
//

Text Mined References (17)

PMID Year Title
25760060 2015 iTRAQ-based quantitative proteomic analysis of cerebrospinal fluid reveals NELL2 as a potential diagnostic biomarker of tuberculous meningitis.
25726761 2015 Expression and regulatory effects on cancer cell behavior of NELL1 and NELL2 in human renal cell carcinoma.
25537860 2015 NELL2 function in the protection of cells against endoplasmic reticulum stress.
23829315 2013 The E2F1 oncogene transcriptionally regulates NELL2 in cancer cells.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19249368 2009 In vitro guidance of retinal axons by a tectal lamina-specific glycoprotein Nel.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16541075 2006 The finished DNA sequence of human chromosome 12.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10548494 1999 Biochemical characterization and expression analysis of neural thrombospondin-1-like proteins NELL1 and NELL2.
10231576 1999 The neuronal EGF-related genes NELL1 and NELL2 are expressed in hemopoietic cells and developmentally regulated in the B lineage.
9480764 1998 Merging extracellular domains: fold prediction for laminin G-like and amino-terminal thrombospondin-like modules based on homology to pentraxins.
8975702 1996 Cloning and characterization of two novel human cDNAs (NELL1 and NELL2) encoding proteins with six EGF-like repeats.