Property Summary

NCBI Gene PubMed Count 56
PubMed Score 66.03
PubTator Score 48.73

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -2.800 2.2e-03
posterior fossa group A ependymoma -3.100 3.4e-13
oligodendroglioma -1.800 4.0e-02
glioblastoma -3.000 3.3e-04
medulloblastoma -3.900 6.6e-08
atypical teratoid / rhabdoid tumor -3.600 6.0e-09
medulloblastoma, large-cell -3.300 5.8e-05
lung cancer 4.500 2.3e-05
adult high grade glioma -2.600 1.4e-04
pilocytic astrocytoma -2.600 1.5e-05
subependymal giant cell astrocytoma -2.027 4.2e-02
Pick disease -1.800 1.3e-02
pituitary cancer -1.900 1.2e-03
psoriasis -2.600 4.2e-25

Gene RIF (37)

PMID Text
26772960 establish the feasibility of combining NELL-1 with BMP2 to improve clinical bone regeneration and provide mechanistic insight into canonical Wnt pathway activity during NELL-1 and BMP2 osteogenesis
26700847 lipoaspirate-derived hPSCs present a novel and abundant cell source of MSCs for cartilage regeneration, and the combinatorial application of NELL-1, TGF-beta3, and BMP-6 with hPSCs may remarkably enhance and accelerate cartilage repair.
26627376 Data suggest that TSPN (N-terminal thrombospondin-1-like) domain of NELL1 exhibits major heparin-binding sites which may be involved in interaction of NELL1 with cell surface heparan sulfate proteoglycans.
26090379 We also detected lower relative expression of Nell-1 by real-time PCR. Furthermore, immunohistochemical analyses revealed that Nell-1 staining was less intense in cancer tissue relative to normal tissue and that the tumor cells had spread to the muscle
26082355 NELL-1 signaling activates Wnt/beta-catenin signaling.
25791475 NELL-1 demonstrates diffuse and reliable expression in benign but not malignant bone-forming skeletal tumors
25726761 CpG islands in the NELL1 and NELL2 promoters are hypermethylated in renal cell carcinoma.NELL1 and NELL2 protein expression is downregulated in clear cell renal carcinoma.
25220281 NELL1 overexpression greatly enhanced the osteogenic differentiation and mineral synthesis of iPSC-MSCs on RGD-grafted CPC scaffold for the first time.
23400010 Two single-nucleotide polymorphisms of the NELL1 gene may represent a novel mechanism underlying hydrochlorothiazide-induced adverse metabolic effects (meta-analysis).
23017834 Data indicate that LvNELL1 infection promoted the osteogenic differentiation of hADSCs, and the effect was comparable with that of LvBMP2.
22797704 Activation of the JNK pathway is necessary to mediate terminal osteogenic different-iation of Saos-2 osteosarcoma cells by rhNELL-1.
22767336 NELL1 is able to promote the osteogenic differentiation of periodontal ligament stem cells, which may be related to the downregulation of Msx2 expression.
22580275 These results identify one potential mechanism of action for rhNELL-1 induced osteogenesis and highlight a fundamental difference between NELL-1 and BMP-2 signaling.
22495925 Prediction of radiographic severity in Ankolysing Spondylitis based on clinical variables can be significantly improved by including SNPs at ADRB1 (rs1801253), NELL1 (rs8176785) and MHC (rs1634747, rs9270986, rs7451962 and rs241453) genes.
22264144 SHH and NELL-1 directed signaling produced additive effects on the pro-osteogenic and antiadipogenic differentiation of adipose derived stem cells.
21931789 Results suggest that Osterix is a direct transcriptional regulator with repressive effect on NELL-1 gene expression, contributing to a delicate balance of regulatory effects on NELL-1 transcription with Runx2.
21902605 NELL-1 may produce functional cartilage with properties similar to native cartilage.
21723284 the effects of NELL-1 on osteoblastic differentiation and proliferation are partly through binding to APR3
21615216 Nell-1 is a candidate growth factor able to induce pericyte osteogenic differentiation.
21472827 Genome-wide association studies-reported associations between the NELL1, NCF4, and FAM92B genes and susceptibility to Crohn's disease could not be replicated in Canadian children and young adults.
20959151 The osteogenic effects of NELL1 on femoral distraction osteogenesis, was investigated.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20647499 a potent growth factor that is highly specific to the osteochondral lineage, and has demonstrated robust induction of bone in multiple in vivo models [review]
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20200953 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19422935 Observational study of gene-disease association. (HuGE Navigator)
19174780 Observational study of gene-disease association. (HuGE Navigator)
18987618 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
18519826 Clinical trial and genome-wide association study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18082140 findings suggest that upon binding to a specific receptor NELL1 transduces an osteogenic signal through activation of certain Tyr-kinases associated with the Ras-MAPK cascade, and finally leads to the osteogenic differentiation
17684544 Data indicate that NELL1 is a ubiquitous inflammatory bowel disease susceptibility locus.
17684544 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
17452981 Promoter hypermethylation of NELL1 is a common, tissue-specific event in human EAC, occurs early during Barrett's-associated esophageal neoplastic progression, and is a potential biomarker of poor prognosis in early-stage EAC
17042739 Runx2 directly binds to the osteoblast specific binding elements 2 elements and transactivates the human NELL-1 promoter.
12235118 Transgenic mice overexpressing Nell-1 develop craniosynostosis.

AA Sequence

MPMDLILVVWFCVCTARTVVGFGMDPDLQMDIVTELDLVNTTLGVAQVSGMHNASKAFLFQDIEREIHAA      1 - 70
PHVSEKLIQLFRNKSEFTILATVQQKPSTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEAL     71 - 140
PYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPDTNLPPGINLWLGQRNQKHGLFKGIIQDGKII    141 - 210
FMPNGYITQCPNLNHTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLY    211 - 280
RDQDSWVDGDHCRNCTCKSGAVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILT    281 - 350
KSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS    351 - 420
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDEN    421 - 490
AICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSGFTGSHCEKDIDECSEGIIEC    491 - 560
HNHSRCVNLPGWYHCECRSGFHDDGTYSLSGESCIDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSC    561 - 630
SGDCPHEGGLKHNGQVWTLKEDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGH    631 - 700
KLYRSGDNWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNITYDIRKTCLDS    701 - 770
YGVSRLSGSVWTMAGSPCTTCKCKNGRVCCSVDFECLQNN                                  771 - 810
//

Text Mined References (58)

PMID Year Title
26772960 2016 Novel Wnt Regulator NEL-Like Molecule-1 Antagonizes Adipogenesis and Augments Osteogenesis Induced by Bone Morphogenetic Protein 2.
26700847 2016 Accelerated Chondrogenic Differentiation of Human Perivascular Stem Cells with NELL-1.
26627376 2015 Mapping the heparin-binding site of the osteoinductive protein NELL1 by site-directed mutagenesis.
26090379 2015 MALDI-TOF Mass Array Analysis of Nell-1 Promoter Methylation Patterns in Human Gastric Cancer.
26082355 2015 NELL-1 in the treatment of osteoporotic bone loss.
25791475 2015 NELL-1 expression in benign and malignant bone tumors.
25726761 2015 Expression and regulatory effects on cancer cell behavior of NELL1 and NELL2 in human renal cell carcinoma.
25220281 2014 Effect of NELL1 gene overexpression in iPSC-MSCs seeded on calcium phosphate cement.
24563467 2014 Oligomerization-induced conformational change in the C-terminal region of Nel-like molecule 1 (NELL1) protein is necessary for the efficient mediation of murine MC3T3-E1 cell adhesion and spreading.
24335144 2013 Human NELL1 protein augments constructive tissue remodeling with biologic scaffolds.
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23017834 2012 Lentiviral-mediated gene transfer into human adipose-derived stem cells: role of NELL1 versus BMP2 in osteogenesis and adipogenesis in vitro.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22823124 2013 The genetic aetiology of cannabis use initiation: a meta-analysis of genome-wide association studies and a SNP-based heritability estimation.
22797704 2012 NELL-1-dependent mineralisation of Saos-2 human osteosarcoma cells is mediated via c-Jun N-terminal kinase pathway activation.
22767336 2012 Osteogenic differentiation of human periodontal ligament stem cells expressing lentiviral NEL-like protein 1.
22580275 2012 NELL-1 increases pre-osteoblast mineralization using both phosphate transporter Pit1 and Pit2.
22495925 2012 Genetic polymorphisms inside and outside the MHC improve prediction of AS radiographic severity in addition to clinical variables.
22379998 2012 Genome-wide mapping for clinically relevant predictors of lamotrigine- and phenytoin-induced hypersensitivity reactions.
22264144 2012 Additive effects of sonic hedgehog and Nell-1 signaling in osteogenic versus adipogenic differentiation of human adipose-derived stromal cells.
21931789 2011 NELL-1, an osteoinductive factor, is a direct transcriptional target of Osterix.
21902605 2012 NELL-1 promotes cartilage regeneration in an in vivo rabbit model.
21723284 2011 NELL-1 binds to APR3 affecting human osteoblast proliferation and differentiation.
21615216 2011 The Nell-1 growth factor stimulates bone formation by purified human perivascular cells.
21472827 2012 NELL1, NCF4, and FAM92B genes are not major susceptibility genes for Crohn's disease in Canadian children and young adults.
20959151 2011 NELL1 promotes high-quality bone regeneration in rat femoral distraction osteogenesis model.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20647499 2010 The role of NELL-1, a growth factor associated with craniosynostosis, in promoting bone regeneration.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20200953 2010 Genome-wide pleiotropy of osteoporosis-related phenotypes: the Framingham Study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19422935 2009 Genetic risk profiling and prediction of disease course in Crohn's disease patients.
19174780 2009 Confirmation of multiple Crohn's disease susceptibility loci in a large Dutch-Belgian cohort.
18987618 2009 Screening for replication of genome-wide SNP associations in sporadic ALS.
18519826 2008 Molecular genetics of successful smoking cessation: convergent genome-wide association study results.
18082140 2008 Involvement of MAPK signaling molecules and Runx2 in the NELL1-induced osteoblastic differentiation.
17684544 2007 Systematic association mapping identifies NELL1 as a novel IBD disease gene.
17452981 2007 Hypermethylation of the nel-like 1 gene is a common and early event and is associated with poor prognosis in early-stage esophageal adenocarcinoma.
17042739 2007 Craniosynostosis-associated gene nell-1 is regulated by runx2.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16713569 2006 A protein-protein interaction network for human inherited ataxias and disorders of Purkinje cell degeneration.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15124103 2004 The novel gene encoding a putative transmembrane protein is mutated in gnathodiaphyseal dysplasia (GDD).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14659887 2003 Identification of NAD+-dependent isocitrate dehydrogenase 3 gamma-like (IDH3GL) gene and its genetic polymorphisms.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12235118 2002 Craniosynostosis in transgenic mice overexpressing Nell-1.
11803583 2001 Brain specific human genes, NELL1 and NELL2, are predominantly expressed in neuroblastoma and other embryonal neuroepithelial tumors.
10548494 1999 Biochemical characterization and expression analysis of neural thrombospondin-1-like proteins NELL1 and NELL2.
10231576 1999 The neuronal EGF-related genes NELL1 and NELL2 are expressed in hemopoietic cells and developmentally regulated in the B lineage.
9893069 1999 Human NELL-1 expressed in unilateral coronal synostosis.
8975702 1996 Cloning and characterization of two novel human cDNAs (NELL1 and NELL2) encoding proteins with six EGF-like repeats.
7757816 1995 [IMAGE: molecular integration of the analysis of the human genome and its expression].