Property Summary

NCBI Gene PubMed Count 44
PubMed Score 27.62
PubTator Score 39.31

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.272 2.6e-03
acute quadriplegic myopathy 1.126 7.1e-08
non primary Sjogren syndrome sicca 1.200 4.8e-02
ovarian cancer 1.700 3.8e-04

Gene RIF (25)

PMID Text
26504077 novel actions of BRD4 and of NELF-E in GR-controlled gene induction have been uncovered.
24636995 Following NELF-E knockdown or tumor necrosis factor alpha stimulation, promoter-proximal RNAP II levels increase up to 3-fold, and there is a dramatic increase in RNAP II levels within the HIV genome.
24636995 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
24636995 Knockdown of NELF-E by shRNA enhances HIV-1 transcription in latently infected cells
24453987 these results describe the RNA binding behavior of NELF-E and supports a biological role for NELF-E in promoter-proximal pausing of both HIV-1 and cellular genes.
24158816 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
22740393 the transcription elongation of KSHV OriLytL-K7 lytic genes is inhibited by NELF during latency, but can also be promptly reactivated in an RTA-independent manner upon external stimuli
22614758 Multivariate analysis revealed that RDBP protein levels were an independent risk factor for early intrahepatic recurrence of HCC within 2 years of surgery.
20471948 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
20097260 Transient NELF-E knock-down in pituitary increased coincidentally prolactin expression and enhanced transcription of a prolactin-promoter reporter gene.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19556007 Our results do not support any major role of the 4 AMD-associated variants in the risk of developing PCV, but favor a predominant association with the RDBP-SKIV2L variants
19556007 Observational study of gene-disease association. (HuGE Navigator)
19245807 data show that NELF subunits exhibit highly specific subcellular localizations, such as in NELF bodies or in midbodies, and some shuttle actively between the nucleus and cytoplasm; loss of NELF from cells can lead to enlarged and/or multiple nuclei
19143814 Observational study of gene-disease association. (HuGE Navigator)
19115949 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)
18303858 RNA binding to NELF-E RRM induces formation of a helix in the C-terminus. RNA-bound form of NELF-E RRM is very similar to RNA-bound form of U1A RRM, although C-terminus of NELF-E RRM is unstructured in free protein, whereas it is helical in U1A protein.
17499042 Negative elongation factor (NELF) is a four subunit transcription factor. Our results point to a surprising role of NELF in the 3' end processing of histone mRNAs and suggest that NELF is a new factor that coordinates mRNA processing in transcription.
17442680 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
16898873 NELF E RRM binds to the single-stranded TAR RNAs with K(d) values in the low-micromolar range.
16880520 5,6-dichloro-1-beta-D-ribofuranosylbenzimidazole sensitivity-inducing factor (DSIF)- and NELF-mediated transcriptional pausing has a dual function in regulating immediate-early expression of the human junB gene.
16838299 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
12612062 NELF-C and NELF-D are highly related or identical to the protein called TH1, of unknown function. NELF-B and NELF-C or NELF-D are integral subunits that bring NELF-A and NELF-E together. [NELF-B] [NELF-C]
11940650 Evidence that negative elongation factor represses transcription elongation through binding to a DRB sensitivity-inducing factor/RNA polymerase II complex and RNA
11112772 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex

AA Sequence

MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVK      1 - 70
SGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSS     71 - 140
DRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSASPPRSRSRDRSHERNRDRDRDRERDRDRDR    141 - 210
DRDRERDRDRDRDRDRDRERDRDRERDRDRDREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAF    211 - 280
SPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAV    281 - 350
QNSPKGCHRDKRTQIVYSDDVYKENLVDGF                                            351 - 380
//

Text Mined References (57)

PMID Year Title
26504077 2016 Kinetically Defined Mechanisms and Positions of Action of Two New Modulators of Glucocorticoid Receptor-regulated Gene Induction.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24636995 2014 Negative elongation factor is required for the maintenance of proviral latency but does not induce promoter-proximal pausing of RNA polymerase II on the HIV long terminal repeat.
24453987 2014 Defining NELF-E RNA binding in HIV-1 and promoter-proximal pause regions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23577725 2013 Genetic factors in nonsmokers with age-related macular degeneration revealed through genome-wide gene-environment interaction analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22740393 2012 Negative elongation factor-mediated suppression of RNA polymerase II elongation of Kaposi's sarcoma-associated herpesvirus lytic gene expression.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22614758 2012 Overexpression of the RD RNA binding protein in hepatitis C virus-related hepatocellular carcinoma.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20097260 2010 Transcription elongation factors are involved in programming hormone production in pituitary neuroendocrine GH4C1 cells.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19575011 2009 CDK9 directs H2B monoubiquitination and controls replication-dependent histone mRNA 3'-end processing.
19556007 2009 Role of RDBP and SKIV2L variants in the major histocompatibility complex class III region in polypoidal choroidal vasculopathy etiology.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19245807 2009 Cellular dynamics of the negative transcription elongation factor NELF.
19143814 2009 Several loci in the HLA class III region are associated with T1D risk after adjusting for DRB1-DQB1.
19115949 2009 Genomewide association study of an AIDS-nonprogression cohort emphasizes the role played by HLA genes (ANRS Genomewide Association Study 02).
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18303858 2008 NELF-E RRM undergoes major structural changes in flexible protein regions on target RNA binding.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17499042 2007 NELF interacts with CBC and participates in 3' end processing of replication-dependent histone mRNAs.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16898873 2006 Structural studies on the RNA-recognition motif of NELF E, a cellular negative transcription elongation factor involved in the regulation of HIV transcription.
16880520 2006 Transcriptional pausing caused by NELF plays a dual role in regulating immediate-early expression of the junB gene.
15561718 2005 Systematic identification and analysis of mammalian small ubiquitin-like modifier substrates.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342491 2004 Attenuation of estrogen receptor alpha-mediated transcription through estrogen-stimulated recruitment of a negative elongation factor.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
14656967 2003 Analysis of the gene-dense major histocompatibility complex class III region and its comparison to mouse.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12676794 2003 The RNA polymerase II elongation complex.
12612062 2003 Human transcription elongation factor NELF: identification of novel subunits and reconstitution of the functionally active complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11940650 2002 Evidence that negative elongation factor represses transcription elongation through binding to a DRB sensitivity-inducing factor/RNA polymerase II complex and RNA.
11112772 2001 DSIF and NELF interact with RNA polymerase II elongation complex and HIV-1 Tat stimulates P-TEFb-mediated phosphorylation of RNA polymerase II and DSIF during transcription elongation.
10199401 1999 NELF, a multisubunit complex containing RD, cooperates with DSIF to repress RNA polymerase II elongation.
10072631 1998 Molecular genetics of the human MHC complement gene cluster.
9799600 1998 Four ubiquitously expressed genes, RD (D6S45)-SKI2W (SKIV2L)-DOM3Z-RP1 (D6S60E), are present between complement component genes factor B and C4 in the class III region of the HLA.
9776767 1998 A method for global protein expression and antibody screening on high-density filters of an arrayed cDNA library.
9264031 1997 Genomic organization of the human DDX13 gene located between RD and RP1 in the class III MHC complex.
8373374 1993 cDNA cloning and characterization of the protein encoded by RD, a gene located in the class III region of the human major histocompatibility complex.
3353717 1988 A previously undetected MHC gene with an unusual periodic structure.
2612324 1989 Structure of the human RD gene: a highly conserved gene in the class III region of the major histocompatibility complex.
2119325 1990 The human RD protein is closely related to nuclear RNA-binding proteins and has been highly conserved.