Property Summary

NCBI Gene PubMed Count 34
PubMed Score 15.34
PubTator Score 13.82

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8491 7.2e-07
psoriasis 6685 2.0e-04
Disease Target Count Z-score Confidence
Breast cancer 3098 3.123 1.6

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.300 2.0e-04
ovarian cancer 1.700 7.2e-07

Gene RIF (20)

PMID Text
26010750 both human and mouse NELF-B proteins are translated from a non-AUG codon upstream of the annotated AUG.
24636995 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
24636995 Knockdown of NELF-B by shRNA enhances HIV-1 transcription in latently infected cells
24158816 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
24097989 These studies allow us to position the actions of two new modulators of GR-regulated transactivation, NELF-A and NELF-B, relative to other factors in the overall gene induction sequence.
23518577 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
19245807 data show that NELF subunits exhibit highly specific subcellular localizations, such as in NELF bodies or in midbodies, and some shuttle actively between the nucleus and cytoplasm; loss of NELF from cells can lead to enlarged and/or multiple nuclei
18071589 COBRA1 and BRCA1 may engage in common gene regulatory pathways to suppress breast cancer progression.
17910036 a lack of COBRA1 expression in breast carcinoma may serve as a useful indicator for poor prognosis.
17659869 COBRA1 may coordinate multiple steps in ligand-dependent gene expression, which in turn ensures both the quantity and quality of hormone-stimulated gene products
17499042 Negative elongation factor (NELF) is a four subunit transcription factor. Our results point to a surprising role of NELF in the 3' end processing of histone mRNAs and suggest that NELF is a new factor that coordinates mRNA processing in transcription.
17442680 Decreasing NELF also correlated with displacement of a positioned nucleosome and increased acetylation of histone H4, suggesting coupling of transcription elongation and chromatin remodeling
17442680 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
17442680 Knockdown of NELF-B by shRNA enhances HIV-1 transcription in latently infected cells
16838299 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
16452188 COBRA1 can negatively regulate the activator protein-1 (AP-1) complex at the TFF1 promoter and thus down-regulate TFF1 expression in gastric cancer cell lines.
15530430 COBRA1 may directly modulate AP-1 pathway and, therefore, may play important roles in cell proliferation, differentiation, apoptosis, and oncogenesis.
15185750 differentially expressed in breast cancer cell lines, antibody to it may be a useful tool to investigate its functions
12612062 NELF-C and NELF-D are highly related or identical to the protein called TH1, of unknown function. NELF-B and NELF-C or NELF-D are integral subunits that bring NELF-A and NELF-E together. [NELF-B] [NELF-C]
11112772 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex

AA Sequence

MFAGLQDLGVANGEDLKETLTNCTEPLKAIEQFQTENGVLLPSLQSALPFLDLHGTPRLEFHQSVFDELR      1 - 70
DKLLERVSAIASEGKAEERYKKLEDLLEKSFSLVKMPSLQPVVMCVMKHLPKVPEKKLKLVMADKELYRA     71 - 140
CAVEVKRQIWQDNQALFGDEVSPLLKQYILEKESALFSTELSVLHNFFSPSPKTRRQGEVVQRLTRMVGK    141 - 210
NVKLYDMVLQFLRTLFLRTRNVHYCTLRAELLMSLHDLDVGEICTVDPCHKFTWCLDACIRERFVDSKRA    211 - 280
RELQGFLDGVKKGQEQVLGDLSMILCDPFAINTLALSTVRHLQELVGQETLPRDSPDLLLLLRLLALGQG    281 - 350
AWDMIDSQVFKEPKMEVELITRFLPMLMSFLVDDYTFNVDQKLPAEEKAPVSYPNTLPESFTKFLQEQRM    351 - 420
ACEVGLYYVLHITKQRNKNALLRLLPGLVETFGDLAFGDIFLHLLTGNLALLADEFALEDFCSSLFDGFF    421 - 490
LTASPRKENVHRHALRLLIHLHPRVAPSKLEALQKALEPTGQSGEAVKELYSQLGEKLEQLDHRKPSPAQ    491 - 560
AAETPALELPLPSVPAPAPL                                                      561 - 580
//

Text Mined References (45)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26010750 2015 Translational Initiation at a Non-AUG Start Codon for Human and Mouse Negative Elongation Factor-B.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097989 2013 A conserved protein motif is required for full modulatory activity of negative elongation factor subunits NELF-A and NELF-B in modifying glucocorticoid receptor-regulated gene induction properties.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21153684 2011 Characterizing the novel protein p33MONOX.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19245807 2009 Cellular dynamics of the negative transcription elongation factor NELF.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18071589 2007 Concerted transcriptional regulation by BRCA1 and COBRA1 in breast cancer cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17910036 2008 Deregulation of cofactor of BRCA1 expression in breast cancer cells.
17659869 Cofactor of BRCA1 modulates androgen-dependent transcription and alternative splicing.
17499042 2007 NELF interacts with CBC and participates in 3' end processing of replication-dependent histone mRNAs.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
17442680 2007 Negative elongation factor NELF represses human immunodeficiency virus transcription by pausing the RNA polymerase II complex.
16964243 2006 A probability-based approach for high-throughput protein phosphorylation analysis and site localization.
16452188 2006 Cofactor of BRCA1: a novel transcription factor regulator in upper gastrointestinal adenocarcinomas.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15530430 2004 COBRA1 inhibits AP-1 transcriptional activity in transfected cells.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342491 2004 Attenuation of estrogen receptor alpha-mediated transcription through estrogen-stimulated recruitment of a negative elongation factor.
15302935 2004 Large-scale characterization of HeLa cell nuclear phosphoproteins.
15185750 2004 Characterization of COBRA1 in human breast cancer cell lines using a new polyclonal antibody against COBRA1.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14667819 2004 Analysis of a high-throughput yeast two-hybrid system and its use to predict the function of intracellular proteins encoded within the human MHC class III region.
12676794 2003 The RNA polymerase II elongation complex.
12612062 2003 Human transcription elongation factor NELF: identification of novel subunits and reconstitution of the functionally active complex.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11739404 2001 BRCA1-induced large-scale chromatin unfolding and allele-specific effects of cancer-predisposing mutations.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11112772 2001 DSIF and NELF interact with RNA polymerase II elongation complex and HIV-1 Tat stimulates P-TEFb-mediated phosphorylation of RNA polymerase II and DSIF during transcription elongation.
11076863 2000 DNA cloning using in vitro site-specific recombination.
10574461 1999 Characterization of cDNA clones selected by the GeneMark analysis from size-fractionated cDNA libraries from human brain.
10199401 1999 NELF, a multisubunit complex containing RD, cooperates with DSIF to repress RNA polymerase II elongation.