Property Summary

NCBI Gene PubMed Count 43
PubMed Score 33.78
PubTator Score 36.81

Knowledge Summary

Patent (5,218)

Expression

  Differential Expression (15)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (25)

PMID Text
26259750 Overexpression of AURKA and NEK6 genes was significantly more pronounced in Ulcerative colitis patients with more extensive colon involvement
25940345 Nek6 facilitates association of Hsp72 with the mitotic spindle, where it promotes stable K-fiber assembly through recruitment of the ch-TOG-TACC3 complex.
25523445 NEK6 suppresses the cell growth arrest induced by TGFbeta. Mechanically, NEK6 blocks nuclear translocation of Smad4, which is essential for TGFbeta function.
24763737 Nek6 is also a critical signaling molecule that helps prevent cardiac hypertrophy and inhibits the Akt signaling pathway.
23416273 Nek6 plays an important role in the premature senescence of cancer cells.
21725899 High Nek6 is associated with hepatic cell cancer.
21642957 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
21539811 These results suggest that the increased expression of Nek6 renders cancer cells resistant to premature senescence, and targeting Nek6 could be an efficient strategy for cancer treatment.
21454704 DYNLL/LC8 protein controls signal transduction through the Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
21320329 the first low resolution 3D structure of hNek6 protein in solution
21099361 NEK6 expression is downregulated in both replicative and premature senscence of human cnacer cells, and the inhibition of Nek6 activity is important for the onset of cellular senescence.
20873783 Findings open new perspectives in the study of hNek6 role in cancer by analyzing its novel interactions in specific pathways in tumor cells, which may provide important implications for drug design and cancer therapy.
20677014 Observational study of gene-disease association. (HuGE Navigator)
20595392 NEK6 is overexpressed in various human cancer tissues, and ectopic expression of NEK6 increases tumor promoter-induced transformation of JB6 Cl41 mouse epidermal cells.
20407017 A pivotal role is indicated for Nek6 in tumorigenesis that establishes Nek6 as a potential target for treatment of a variety of human cancers.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19414596 both Nek6 and Nek7 are activated in mitosis and that interfering with their activity by either depletion or expression of reduced-activity mutants leads to mitotic arrest and apoptosis
18728393 These results suggest that Nek6 is a novel target of the DNA damage checkpoint and that the inhibition of Nek6 activity is required for proper cell cycle arrest in the G(2)/M phase upon DNA damage.
17512906 Nek6 binds to Fe65 through its (267)PPLP(270) motif; the protein-protein interaction between Nek6 and Fe65 regulates their subcellular localization and cell apoptosis
16476580 we found that Pin1 could interact with Nek6, one of the human NIMA-related kinases (Neks). Significant correlations between Nek6 and Pin1 mRNA expression levels in 40 pairs of hepatocellular carcinoma cases.
14563848 Nek6 kinase is required for the metaphase-anaphase transition
12840024 Activated by Nercc1/NEK9; part of the mitotic casscade
12054534 molecular cloning and characterization of Nek6
12023960 Molecular basis for the substrate specificity
11701951 Also includes phylogenetic analysis and tissue-specific RT-PCR of human NEK6 and NEK7.

AA Sequence

MAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTLSFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKT      1 - 70
VALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNIIKYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQ     71 - 140
KRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPANVFITATGVVKLGDLGLGRFFSSETTAAHSLVGT    141 - 210
PYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSPFYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRE    211 - 280
LVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST                                         281 - 313
//

Text Mined References (48)

PMID Year Title
26259750 2015 Never in mitosis gene A-related kinase 6 and aurora kinase A: New gene biomarkers in the conversion from ulcerative colitis to colorectal cancer.
25940345 2015 Hsp72 is targeted to the mitotic spindle by Nek6 to promote K-fiber assembly and mitotic progression.
25523445 2015 An inhibitory role of NEK6 in TGF?/Smad signaling pathway.
25416956 2014 A proteome-scale map of the human interactome network.
24763737 2014 Never in mitosis gene A related kinase-6 attenuates pressure overload-induced activation of the protein kinase B pathway and cardiac hypertrophy.
23416273 2013 The inhibition of Nek6 function sensitizes human cancer cells to premature senescence upon serum reduction or anticancer drug treatment.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21725899 2012 Clinical and biological significance of never in mitosis gene A-related kinase 6 (NEK6) expression in hepatic cell cancer.
21642957 2011 Nek9 is a Plk1-activated kinase that controls early centrosome separation through Nek6/7 and Eg5.
21539811 2011 Nek6 suppresses the premature senescence of human cancer cells induced by camptothecin and doxorubicin treatment.
21454704 2011 DYNLL/LC8 protein controls signal transduction through the Nek9/Nek6 signaling module by regulating Nek6 binding to Nek9.
21320329 2011 Human Nek6 is a monomeric mostly globular kinase with an unfolded short N-terminal domain.
21200151 2011 A role for Nek6 kinase activity in preventing senescence?
21099361 2010 Nek6 overexpression antagonizes p53-induced senescence in human cancer cells.
20873783 2010 Characterization of hNek6 interactome reveals an important role for its short N-terminal domain and colocalization with proteins at the centrosome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20595392 2010 Role of NEK6 in tumor promoter-induced transformation in JB6 C141 mouse skin epidermal cells.
20407017 2010 Nek6 mediates human cancer cell transformation and is a potential cancer therapeutic target.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19941817 2009 An autoinhibitory tyrosine motif in the cell-cycle-regulated Nek7 kinase is released through binding of Nek9.
19414596 2009 The Nek6 and Nek7 protein kinases are required for robust mitotic spindle formation and cytokinesis.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19001501 2008 The NIMA-family kinase Nek6 phosphorylates the kinesin Eg5 at a novel site necessary for mitotic spindle formation.
18728393 2008 Nek6 is involved in G2/M phase cell cycle arrest through DNA damage-induced phosphorylation.
17512906 2007 Human NIMA-related kinase 6 is one of the Fe65 WW domain binding proteins.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16476580 2006 Interaction of Pin1 with Nek6 and characterization of their expression correlation in Chinese hepatocellular carcinoma patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16280549 2005 Caught Nek-ing: cilia and centrioles.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15761153 2005 High-throughput mapping of a dynamic signaling network in mammalian cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15164053 2004 DNA sequence and analysis of human chromosome 9.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14563848 2003 The serine/threonine kinase Nek6 is required for cell cycle progression through mitosis.
12840024 2003 A mitotic cascade of NIMA family kinases. Nercc1/Nek9 activates the Nek6 and Nek7 kinases.
12761501 2003 Large-scale identification and characterization of human genes that activate NF-kappaB and MAPK signaling pathways.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12101123 2002 Nercc1, a mammalian NIMA-family kinase, binds the Ran GTPase and regulates mitotic progression.
12054534 2002 Identification and characterization of Nek6 protein kinase, a potential human homolog of NIMA histone H3 kinase.
12023960 2002 Molecular basis for the substrate specificity of NIMA-related kinase-6 (NEK6). Evidence that NEK6 does not phosphorylate the hydrophobic motif of ribosomal S6 protein kinase and serum- and glucocorticoid-induced protein kinase in vivo.
11701951 2001 Identification and assignment of the human NIMA-related protein kinase 7 gene (NEK7) to human chromosome 1q31.3.
11516946 2001 Identification of the NIMA family kinases NEK6/7 as regulators of the p70 ribosomal S6 kinase.
10964517 2000 Isolation and characterization of two evolutionarily conserved murine kinases (Nek6 and nek7) related to the fungal mitotic regulator, NIMA.
10702691 1999 Assignment of NEK6, a NIMA-related gene, to human chromosome 9q33. 3-->q34.11 by radiation hybrid mapping.
10191262 1999 Activation of serum- and glucocorticoid-regulated protein kinase by agonists that activate phosphatidylinositide 3-kinase is mediated by 3-phosphoinositide-dependent protein kinase-1 (PDK1) and PDK2.