Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.63
PubTator Score 9.90

Knowledge Summary

Patent (2,497)

Expression

  Differential Expression (17)

Disease log2 FC p
chronic lymphocytic leukemia 1.074 3.4e-03
esophageal adenocarcinoma 1.100 3.0e-02
psoriasis -1.800 3.2e-04
osteosarcoma -1.684 1.6e-04
atypical teratoid / rhabdoid tumor 1.400 2.0e-08
glioblastoma 1.100 9.0e-05
medulloblastoma 1.100 1.5e-03
medulloblastoma, large-cell 1.200 4.0e-04
primitive neuroectodermal tumor 1.600 1.9e-04
tuberculosis and treatment for 3 months 1.300 5.5e-06
non-small cell lung cancer -1.026 1.7e-15
lung adenocarcinoma -1.133 2.7e-05
Pick disease -2.200 2.9e-05
progressive supranuclear palsy -2.100 9.6e-03
gastric carcinoma 1.100 4.7e-02
ovarian cancer -1.300 6.2e-07
Breast cancer -1.100 2.9e-05

Gene RIF (5)

PMID Text
21756249 EHD2 interacts with Nek3 [NIMA (never in mitosis in Aspergillus nidulans)-related kinase 3], a serine/threonine kinase.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
17297458 Nek3 contributes to prolactin-mediated breast cancer motility through mechanisms involving Rac1 activation and paxillin phosphorylation.
17118778 Nek3 insertion/deletion polymorphism with alterations at 13q14 is associated with cancers
12063396 Molecular cloning and characterization of the human NIMA-related protein kinase 3 gene (NEK3).

AA Sequence

MDDYMVLRMIGEGSFGRALLVQHESSNQMFAMKEIRLPKSFSNTQNSRKEAVLLAKMKHPNIVAFKESFE      1 - 70
AEGHLYIVMEYCDGGDLMQKIKQQKGKLFPEDMILNWFTQMCLGVNHIHKKRVLHRDIKSKNIFLTQNGK     71 - 140
VKLGDFGSARLLSNPMAFACTYVGTPYYVPPEIWENLPYNNKSDIWSLGCILYELCTLKHPFQANSWKNL    141 - 210
ILKVCQGCISPLPSHYSYELQFLVKQMFKRNPSHRPSATTLLSRGIVARLVQKCLPPEIIMEYGEEVLEE    211 - 280
IKNSKHNTPRKKTNPSRIRIALGNEASTVQEEEQDRKGSHTDLESINENLVESALRRVNREEKGNKSVHL    281 - 350
RKASSPNLHRRQWEKNVPNTALTALENASILTSSLTAEDDRGGSVIKYSKNTTRKQWLKETPDTLLNILK    351 - 420
NADLSLAFQTYTIYRPGSEGFLKGPLSEETEASDSVDGGHDSVILDPERLEPGLDEEDTDFEEEDDNPDW    421 - 490
VSELKKRAGWQGLCDR                                                          491 - 506
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21756249 2011 EHD2 mediates trafficking from the plasma membrane by modulating Rac1 activity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19369195 2009 Large-scale proteomics analysis of the human kinome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17297458 2007 Nek3 kinase regulates prolactin-mediated cytoskeletal reorganization and motility of breast cancer cells.
17118778 2006 Is there any association between nek3 and cancers with frequent 13q14 deletion?
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15618286 2005 Novel association of Vav2 and Nek3 modulates signaling through the human prolactin receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15345747 2004 Phosphoproteomic analysis of the developing mouse brain.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12063396 2001 Molecular cloning and characterization of the human NIMA-related protein kinase 3 gene (NEK3).
10224116 1999 Cloning and characterization of the murine Nek3 protein kinase, a novel member of the NIMA family of putative cell cycle regulators.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8274451 1993 Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans.
7522034 1994 Cell cycle-dependent expression of Nek2, a novel human protein kinase related to the NIMA mitotic regulator of Aspergillus nidulans.