Property Summary

NCBI Gene PubMed Count 91
PubMed Score 141.20
PubTator Score 119.47

Knowledge Summary

Patent (11,248)

Expression

  Differential Expression (30)

Disease log2 FC p
malignant mesothelioma 1.300 2.8e-06
astrocytic glioma -1.500 1.1e-02
oligodendroglioma -1.600 1.1e-02
esophageal adenocarcinoma 1.300 2.1e-02
glioblastoma 1.500 4.6e-03
group 3 medulloblastoma 3.100 5.9e-06
atypical teratoid/rhabdoid tumor 1.900 1.4e-03
medulloblastoma, large-cell 2.100 2.2e-06
primitive neuroectodermal tumor 1.900 1.7e-03
Atopic dermatitis 2.200 4.4e-05
adrenocortical carcinoma 2.102 8.5e-04
non-small cell lung cancer 3.334 1.7e-34
intraductal papillary-mucinous carcinoma... 2.800 9.5e-04
intraductal papillary-mucinous neoplasm ... 3.600 3.5e-03
colon cancer 2.900 4.0e-02
lung cancer 6.000 1.4e-07
pancreatic cancer 2.000 1.2e-06
lung adenocarcinoma 1.700 1.2e-07
pediatric high grade glioma 1.400 4.8e-02
pilocytic astrocytoma -1.200 3.0e-02
posterior fossa group B ependymoma 1.100 3.5e-06
primary Sjogren syndrome 1.100 4.9e-03
psoriasis 1.600 2.1e-115
nasopharyngeal carcinoma 1.400 2.3e-03
Endometriosis 1.303 1.1e-02
Breast cancer 3.700 9.6e-31
breast carcinoma 2.500 1.0e-48
ductal carcinoma in situ 3.100 1.1e-03
invasive ductal carcinoma 3.600 7.8e-06
ovarian cancer 3.400 1.3e-10

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (65)

PMID Text
26851035 Hepatocellular carcinoma patients with high NEK2 expression had significantly poor recurrence-free survival (p=0.042) and early recurrence after hepatectomy.
26823916 Suggest elevated Nek2 protein expression may be an independent risk factor for colon cancer.
26320076 The results suggest that overexpression of NEK2 has the potential to serve as a biomarker for PCa prognosis.
26290419 Kif24 is a physiological substrate of Nek2, which regulates cilia disassembly through a concerted mechanism involving Kif24-mediated microtubule depolymerization.
26220856 Cep85 is a bona fide Nek2A-binding partner that surrounds the proximal ends of centrioles where it cooperates with PP1gamma (also known as PPP1CC) to antagonize Nek2A
25705694 we highlight recent findings on the aberrant expression and functional significance of NEK2A in human cancers and emphasize their significance for therapeutic potentials.
25704143 Nek2 was demonstrated to phosphorylate Cep68 in vivo and this phosphorylation appears to promote Cep68 degradation in mitosis.
25673878 Nek2A is degraded in mitosis regardless of enforced spindle checkpoint activation
25313354 Nek2 plays a central role in proteasome-mediated cell cycle regulation and in conferring resistance to bortezomib in cancer cells.
25230277 Findings are consistent with the hypothesis that NEK2 contributes to ALDH1A1-dependent drug resistance in myeloma
25043295 Overexpression of the Nek2 kinase is associated with colorectal cancer.
24966957 High expression of Nek2 could serve as an independent predictor of poor prognosis in pancreatic ductal adenocarcinoma.
24797070 Data suggest a role for Nek2 driving centrosome amplification downstream of the E2F3 activator.
24763826 Nek2 may represent a new potential target for non-small cell lung cancer therapeutic intervention
24501426 These results identify a novel mechanism for regulating beta-catenin stability that is independent of GSK3beta and provide new insight into a pathway involving Plk1, Nek2, and beta-catenin that regulates the centrosome cycle.
24447338 The amplified luminescent proximity homogeneous assay (AlphaScreen) identifies the interaction of HIV-1 Gag with NEK2
24389189 it appears that Nek2 and Plk4 might synergize to promote breast tumorigenesis and may also be involved in tamoxifen and trastuzumab resistance
24337664 NEK2 directly or indirectly interacts with a number of genes, proteins, microRNAs and biological processes associated with drug resistance in ovarian and other types of cancer.
24214971 CIP2A strongly interacts with NEK2 during G2/M phase, thereby enhancing NEK2 kinase activity to facilitate centrosome separation in a PP1- and PP2A-independent manner.
24163369 NEK2 as a novel p53-repressed gene
24091727 Nek2 overexpression could not induce centrosome amplification and chromosome instability without expression of TRF1.
24046120 Up-regulation of NEK2 by microRNA-128 methylation is associated with colorectal cancer.
24043777 Whole genome sequencing in patients with retinitis pigmentosa reveals pathogenic DNA structural changes and NEK2 as a new disease gene.
23776583 Data conclude that centrosome amplification is modulated through Cdk4 and Nek2 signaling and that binucleation is a likely source of CA in Her2+ breast cancer cells.
23708664 these data indicate that Nek2 has a pivotal role in breast cancer growth at primary and secondary sites, and thus may be an attractive and novel therapeutic target for this disease.
23370767 These results suggest that the malignant transformation of plexiform neurofibroma is associated with distinct changes in the expression of BUB1B, PBK and NEK2
23340795 small interfering RNA and antisense oligonucleotides against Nek2 worked synergistically with paclitaxel and doxorubicin by promoting cell apoptosis.
23291182 NEK2 phosphorylation antagonizes the microtubule stabilizing activity of centrobin.
23288039 Nek2A binds with high affinity to apo-APC/C and is degraded by the pool of Cdc20 that avoids inhibition by the spindle assembly checkpoint.
23001753 Our results indicate that genetic polymorphisms of centrobin and Nek2 are related to breast cancer susceptibility in Chinese Han women.
22879911 Measuring IGF2BP3, HOXB7 and NEK2 mRNA levels by RT-PCR in addition to cytology has the potential to improve detection of malignant biliary disorders from brush cytology specimens.
22824957 Nek2 C downregulation, using RNA interference, decreased the survival, invasion and migration of MCF10DCIS.com and MCF10CA1a cells as well as in human primary breast cancer tissue.
22613497 The recruitment of Nek2 to the proximal ends of centrioles is dependent on one of its substrates, the centrosome cohesion protein C-Nap1.
22234886 Nek2A might bear a close relationship with development and progression of breast carcinoma, and have a role as a potential biomarker for diagnosis and a possible therapeutic target for human breast cancer especially for breast ductal carcinoma in situ.
22014044 This study suggests that abnormal expression of Nek2 and beta-catenin might be one of the mechanisms of tumorigenesis in breast cancer
21832156 Hec1 serine 165 (S165) is preferentially phosphorylated at kinetochores by Nek2 and it serves as an important mechanism in modulating spindle assemble checkpoint signaling and chromosome alignment.
21723128 The counteracting Nek2A and PP1gamma activities on the centrosome linker are controlled by Plk1.
21669869 leucine zipper of Nek2 kinase is the first example where the frameshift of coiled-coil heptad repeats has been directly observed experimentally
21076410 Study reports that two Hippo pathway components, Mst2 and the scaffold protein Salvador (hSav1), directly interact with Nek2A and regulate its ability to localize to centrosomes, and phosphorylate C-Nap1 and rootletin.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20718755 Data show that although NEK2 was not universally recognized, it may serve as a tumor antigen for some patients.
20599736 these results suggest that kendrin anchors Nek2A and suppresses its kinase activity at the centrosomes, and thus, is involved in the mechanism to prevent premature centrosome splitting during interphase.
20581865 Abolishing the expression of cyclin D1, Cdk4 or Nek2 in MCF10A human mammary epithelial cells expressing H-Ras(G12V) abrogated Ras-induced centrosome amplification.
20508983 Observational study of gene-disease association. (HuGE Navigator)
19123481 NEK2 overexpression is associated with papillary renal cell tumors with chromosome 1q duplication.
19038001 Nek2 plays a critical role in carcinogenesis, tumor invasion, and tumorigenic growth of breast carcinoma.
19008095 Observational study of gene-disease association. (HuGE Navigator)
18297113 that Hec1 binds to microtubule in low affinity and phosphorylation by NEK2A, which prevents aberrant kinetochore-microtubule connections in vivo, increases the affinity of the Ndc80 complex for microtubules in vitro
18086858 Nek2 binds and phosphorylates beta-catenin.
17626005 alternative splicing provides an unusual mechanism for modulating Nek2 localization, enabling it to have both nuclear and cytoplasmic functions.
17621308 Results suggest that NEK2A-mediated phosphorylation of Sgo1 (SGOL1) provides a link between centromeric cohesion and spindle microtubule attachment at the kinetochores.
17535851 Results report that NIP2, previously identified as centrobin, is a novel substrate of Nek2, and that NIP2 has a role in stabilizing the microtubule structure.
17283141 Radiation-induced inhibition of centrosome splitting was abrogated in cells expressing Nek2 mutated in the PP1-binding motif outside the kinase domain.
17197699 Mutational analysis of autophosphorylation sites identified by mass spectrometry and x-ray structure show a complex pattern of positive and negative regulatory effects on kinase activity correlated with effects on centrosomal splitting efficiency
16157594 DNA damage-induced inhibition of Plk1 leads to inhibition of Nek2 activity and thus prevents centrosome separation
16084011 summary of the expression, regulation and function of Nek2 and its roles in human cancer [review]
15950749 Down-regulation of NEK2A does not lead to mitotic defects; absence of the isozyme NK2B, a splice variant, leads to a mitotic delay and the formation of multinucleated cells.
15659651 multiple processes involved in regulating the abundance of Nek2 kinase at the centrosome including microtubule binding, the centriolar satellite component pericentriolar material 1, and localized protein degradation
15492258 Nek2 protein is significantly up-regulated in preinvasive in situ ductal carcinomas of the breast as well as in invasive breast carcinomas.
15387139 Nek2 is involved in activation of the G2 checkpoint and is not secondary to cell cycle arrest
15161910 Nucleolar Nek11 is a novel target of Nek2A in G1/S-arrested cells
14978040 NEK2A is a kinetochore-associated protein kinase essential for faithful chromosome segregation
12857871 Nek2A function is required for the correct execution of mitosis
12386167 cell cycle-regulated serine phosphorylation of Hec1 by Nek2 is essential for faithful chromosome segregation
12221103 Nek2.PP1C complex is regulated by Inh2 via inhibition of phosphatase activity to initiate centrosome separation

AA Sequence

MPSRAEDYEVLYTIGTGSYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRY      1 - 70
YDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSDGGHTVLHR     71 - 140
DLKPANVFLDGKQNVKLGDFGLARILNHDTSFAKTFVGTPYYMSPEQMNRMSYNEKSDIWSLGCLLYELC    141 - 210
ALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLIADLVADEQR    211 - 280
RNLERRGRQLGEPEKSQDSSPVLSELKLKEIQLQERERALKAREERLEQKEQELCVRERLAEDKLARAEN    281 - 350
LLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAA    351 - 420
QLRAQALSDIEKNYQLKSRQILGMR                                                 421 - 445
//

Text Mined References (100)

PMID Year Title
26851035 2016 High NEK2 Expression Is a Predictor of Tumor Recurrence in Hepatocellular Carcinoma Patients After Hepatectomy.
26823916 2015 Clinical significance and prognostic value of Nek2 protein expression in colon cancer.
26471995 2015 Characterization of Cep85 - a new antagonist of Nek2A that is involved in the regulation of centrosome disjunction.
26320076 2015 Overexpression of NIMA-related kinase 2 is associated with progression and poor prognosis of prostate cancer.
26290419 2015 Nek2 activation of Kif24 ensures cilium disassembly during the cell cycle.
26220856 2015 Characterization of Cep85 - a new antagonist of Nek2A that is involved in the regulation of centrosome disjunction.
25705694 2015 Role of NEK2A in human cancer and its therapeutic potentials.
25704143 Cep68 can be regulated by Nek2 and SCF complex.
25673878 2015 Nek2A destruction marks APC/C activation at the prophase-to-prometaphase transition by spindle-checkpoint-restricted Cdc20.
25313354 2014 Inhibition of Nek2 by small molecules affects proteasome activity.
25230277 2014 NEK2 mediates ALDH1A1-dependent drug resistance in multiple myeloma.
25043295 2014 Overexpression of the Nek2 kinase in colorectal cancer correlates with beta-catenin relocalization and shortened cancer-specific survival.
24966957 2014 Abnormal expression of Nek2 in pancreatic ductal adenocarcinoma: a novel marker for prognosis.
24797070 2014 E2F activators signal and maintain centrosome amplification in breast cancer cells.
24763826 2014 Examining Nek2 as a better proliferation marker in non-small cell lung cancer prognosis.
24554434 2014 Centlein mediates an interaction between C-Nap1 and Cep68 to maintain centrosome cohesion.
24501426 2014 Nek2 phosphorylates and stabilizes ?-catenin at mitotic centrosomes downstream of Plk1.
24389189 2014 Nek2 and Plk4: prognostic markers, drivers of breast tumorigenesis and drug resistance.
24337664 2014 Upregulation of NEK2 is associated with drug resistance in ovarian cancer.
24214971 2014 Cancerous inhibitor of protein phosphatase 2A (CIP2A) protein is involved in centrosome separation through the regulation of NIMA (never in mitosis gene A)-related kinase 2 (NEK2) protein activity.
24163369 2013 Local depletion of DNA methylation identifies a repressive p53 regulatory region in the NEK2 promoter.
24091727 2013 Mitotic perturbations induced by Nek2 overexpression require interaction with TRF1 in breast cancer cells.
24046120 2014 Up-regulation of NEK2 by microRNA-128 methylation is associated with poor prognosis in colorectal cancer.
24043777 2013 Whole genome sequencing in patients with retinitis pigmentosa reveals pathogenic DNA structural changes and NEK2 as a new disease gene.
23776583 2013 Cdk4 and nek2 signal binucleation and centrosome amplification in a her2+ breast cancer model.
23708664 2014 Role of Nek2 on centrosome duplication and aneuploidy in breast cancer cells.
23370767 2013 Expression profiling of 519 kinase genes in matched malignant peripheral nerve sheath tumor/plexiform neurofibroma samples is discriminatory and identifies mitotic regulators BUB1B, PBK and NEK2 as overexpressed with transformation.
23340795 2013 Nek2-targeted ASO or siRNA pretreatment enhances anticancer drug sensitivity in triple?negative breast cancer cells.
23291182 2013 NEK2 phosphorylation antagonizes the microtubule stabilizing activity of centrobin.
23288039 2013 Mechanisms controlling the temporal degradation of Nek2A and Kif18A by the APC/C-Cdc20 complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23001753 2012 Genetic polymorphisms in centrobin and Nek2 are associated with breast cancer susceptibility in a Chinese Han population.
22879911 2012 Detection of IGF2BP3, HOXB7, and NEK2 mRNA expression in brush cytology specimens as a new diagnostic tool in patients with biliary strictures.
22824957 2012 Nek2C functions as a tumor promoter in human breast tumorigenesis.
22613497 2012 Nek2 localises to the distal portion of the mother centriole/basal body and is required for timely cilium disassembly at the G2/M transition.
22234886 2012 Nek2A contributes to tumorigenic growth and possibly functions as potential therapeutic target for human breast cancer.
22014044 2011 Abnormal expression of Nek2 and ?-catenin in breast carcinoma: clinicopathological correlations.
21832156 2011 Phosphorylation of the Ndc80 complex protein, HEC1, by Nek2 kinase modulates chromosome alignment and signaling of the spindle assembly checkpoint.
21723128 2011 Plk1 controls the Nek2A-PP1? antagonism in centrosome disjunction.
21669869 2011 An undecided coiled coil: the leucine zipper of Nek2 kinase exhibits atypical conformational exchange dynamics.
21531765 2011 High-throughput RNAi screening reveals novel regulators of telomerase.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
21076410 2010 Components of the Hippo pathway cooperate with Nek2 kinase to regulate centrosome disjunction.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20718755 2010 Tumor antigen analysis in neuroblastoma by serological interrogation of bioinformatic data.
20599736 2010 Involvement of a centrosomal protein kendrin in the maintenance of centrosome cohesion by modulating Nek2A kinase activity.
20581865 2010 The Ras oncogene signals centrosome amplification in mammary epithelial cells through cyclin D1/Cdk4 and Nek2.
20508983 2011 Centrosome-related genes, genetic variation, and risk of breast cancer.
20034488 2010 Nek2 targets the mitotic checkpoint proteins Mad2 and Cdc20: a mechanism for aneuploidy in cancer.
19941817 2009 An autoinhibitory tyrosine motif in the cell-cycle-regulated Nek7 kinase is released through binding of Nek9.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19123481 2009 Three genetic developmental stages of papillary renal cell tumors: duplication of chromosome 1q marks fatal progression.
19038001 2009 Nek2 as a novel molecular target for the treatment of breast carcinoma.
19008095 2009 Single nucleotide polymorphisms in chromosomal instability genes and risk and clinical outcome of breast cancer: a Swedish prospective case-control study.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18297113 2008 The mitotic checkpoint kinase NEK2A regulates kinetochore microtubule attachment stability.
18088087 2008 Phosphoproteome of resting human platelets.
18086858 2008 beta-Catenin is a Nek2 substrate involved in centrosome separation.
17626005 2007 Alternative splicing controls nuclear translocation of the cell cycle-regulated Nek2 kinase.
17621308 2007 Phosphorylation of human Sgo1 by NEK2A is essential for chromosome congression in mitosis.
17535851 2007 Characterization of NIP2/centrobin, a novel substrate of Nek2, and its potential role in microtubule stabilization.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
17283141 2007 Protein phosphatase-1alpha regulates centrosome splitting through Nek2.
17197699 2007 Structure and regulation of the human Nek2 centrosomal kinase.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16648845 2006 Early mitotic degradation of Nek2A depends on Cdc20-independent interaction with the APC/C.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16280549 2005 Caught Nek-ing: cilia and centrioles.
16157594 2005 The role of Polo-like kinase 1 in the inhibition of centrosome separation after ionizing radiation.
16084011 2006 Nek2 kinase in chromosome instability and cancer.
15950749 2005 Live cell imaging reveals distinct roles in cell cycle regulation for Nek2A and Nek2B.
15659832 2004 Alternatively spliced protein variants as potential therapeutic targets for male infertility and contraception.
15659651 2005 Dynamic recruitment of Nek2 kinase to the centrosome involves microtubules, PCM-1, and localized proteasomal degradation.
15492258 2004 The centrosomal kinase Nek2 displays elevated levels of protein expression in human breast cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15388344 2004 Nek2A kinase regulates the localization of numatrin to centrosome in mitosis.
15387139 2004 Inhibition of centrosome separation after DNA damage: a role for Nek2.
15358203 2004 Nek2A specifies the centrosomal localization of Erk2.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
15161910 2004 Nucleolar Nek11 is a novel target of Nek2A in G1/S-arrested cells.
14978040 2004 NEK2A interacts with MAD1 and possibly functions as a novel integrator of the spindle checkpoint signaling.
12857871 2003 Nek2A kinase stimulates centrosome disjunction and is required for formation of bipolar mitotic spindles.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12386167 2002 Phosphorylation of the mitotic regulator protein Hec1 by Nek2 kinase is essential for faithful chromosome segregation.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
12221103 2002 Inhibitor-2 regulates protein phosphatase-1 complexed with NimA-related kinase to induce centrosome separation.
11785960 2002 Nek2 localizes to multiple sites in mitotic cells, suggesting its involvement in multiple cellular functions during the cell cycle.
11742988 2001 APC/C-mediated destruction of the centrosomal kinase Nek2A occurs in early mitosis and depends upon a cyclin A-type D-box.
11742531 2002 Alternative splice variants of the human centrosome kinase Nek2 exhibit distinct patterns of expression in mitosis.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
10880350 2000 NIMA-related kinase 2 (Nek2), a cell-cycle-regulated protein kinase localized to centrosomes, is complexed to protein phosphatase 1.
10645953 2000 A preliminary gene map for the Van der Woude syndrome critical region derived from 900 kb of genomic sequence at 1q32-q41.
10347187 1999 Activity of the human centrosomal kinase, Nek2, depends on an unusual leucine zipper dimerization motif.
9647649 1998 C-Nap1, a novel centrosomal coiled-coil protein and candidate substrate of the cell cycle-regulated protein kinase Nek2.
9430639 1998 A centrosomal function for the human Nek2 protein kinase, a member of the NIMA family of cell cycle regulators.
8274451 1993 Identification of 21 novel human protein kinases, including 3 members of a family related to the cell cycle regulator nimA of Aspergillus nidulans.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.
7522034 1994 Cell cycle-dependent expression of Nek2, a novel human protein kinase related to the NIMA mitotic regulator of Aspergillus nidulans.