Property Summary

NCBI Gene PubMed Count 16
PubMed Score 5.52
PubTator Score 5.61

Knowledge Summary

Patent (583)

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.500 2.0e-03
chronic rhinosinusitis -1.038 1.1e-02
cystic fibrosis and chronic rhinosinusit... -1.175 1.1e-02
ependymoma 1.900 5.0e-02
malignant mesothelioma 1.100 3.3e-06
nasopharyngeal carcinoma -1.200 8.9e-07
psoriasis 1.100 1.5e-03

Gene RIF (8)

AA Sequence

MLKFQEAAKCVSGSTAISTYPKTLIARRYVLQQKLGSGSFGTVYLVSDKKAKRGEELKVLKEISVGELNP      1 - 70
NETVQANLEAQLLSKLDHPAIVKFHASFVEQDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFI     71 - 140
QLLLGVDYMHERRILHRDLKSKNVFLKNNLLKIGDFGVSRLLMGSCDLATTLTGTPHYMSPEALKHQGYD    141 - 210
TKSDIWSLACILYEMCCMNHAFAGSNFLSIVLKIVEGDTPSLPERYPKELNAIMESMLNKNPSLRPSAIE    211 - 280
ILKIPYLDEQLQNLMCRYSEMTLEDKNLDCQKEAAHIINAMQKRIHLQTLRALSEVQKMTPRERMRLRKL    281 - 350
QAADEKARKLKKIVEEKYEENSKRMQELRSRNFQQLSVDVLHEKTHLKGMEEKEEQPEGRLSCSPQDEDE    351 - 420
ERWQGREEESDEPTLENLPESQPIPSMDLHELESIVEDATSDLGYHEIPEDPLVAEEYYADAFDSYCEES    421 - 490
DEEEEEIALERPEKEIRNEGSQPAYRTNQQDSDIEALARCLENVLGCTSLDTKTITTMAEDMSPGPPIFN    491 - 560
SVMARTKMKRMRESAMQKLGTEVFEEVYNYLKRARHQNASEAEIRECLEKVVPQASDCFEVDQLLYFEEQ    561 - 630
LLITMGKEPTLQNHL                                                           631 - 645
//

Text Mined References (19)

PMID Year Title