Property Summary

Ligand Count 164
NCBI Gene PubMed Count 37
PubMed Score 47.02
PubTator Score 25.82

Knowledge Summary

Patent (1,615)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.100 8.9e-03
chronic rhinosinusitis -1.342 7.5e-03
cystic fibrosis and chronic rhinosinusit... -1.212 6.0e-03
dermatomyositis 1.100 6.9e-04
osteosarcoma 1.107 2.1e-04
ovarian cancer -1.300 1.3e-04
Pick disease 1.500 3.0e-07
posterior fossa group B ependymoma 1.100 3.8e-05
progressive supranuclear palsy -1.600 4.8e-03
Rheumatoid arthritis 1.400 1.4e-03
tuberculosis -1.400 6.5e-09

Gene RIF (20)

AA Sequence

MEKYVRLQKIGEGSFGKAILVKSTEDGRQYVIKEINISRMSSKEREESRREVAVLANMKHPNIVQYRESF      1 - 70
EENGSLYIVMDYCEGGDLFKRINAQKGVLFQEDQILDWFVQICLALKHVHDRKILHRDIKSQNIFLTKDG     71 - 140
TVQLGDFGIARVLNSTVELARTCIGTPYYLSPEICENKPYNNKSDIWALGCVLYELCTLKHAFEAGSMKN    141 - 210
LVLKIISGSFPPVSLHYSYDLRSLVSQLFKRNPRDRPSVNSILEKGFIAKRIEKFLSPQLIAEEFCLKTF    211 - 280
SKFGSQPIPAKRPASGQNSISVMPAQKITKPAAKYGIPLAYKKYGDKKLHEKKPLQKHKQAHQTPEKRVN    281 - 350
TGEERRKISEEAARKRRLEFIEKEKKQKDQIISLMKAEQMKRQEKERLERINRAREQGWRNVLSAGGSGE    351 - 420
VKAPFLGSGGTIAPSSFSSRGQYEHYHAIFDQMQQQRAEDNEAKWKREIYGRGLPERGILPGVRPGFPYG    421 - 490
AAGHHHFPDADDIRKTLKRLKAVSKQANANRQKGQLAVERAKQVEEFLQRKREAMQNKARAEGHMVYLAR    491 - 560
LRQIRLQNFNERQQIKAKLRGEKKEANHSEGQEGSEEADMRRKKIESLKAHANARAAVLKEQLERKRKEA    561 - 630
YEREKKVWEEHLVAKGVKSSDVSPPLGQHETGGSPSKQQMRSVISVTSALKEVGVDSSLTDTRETSEEMQ    631 - 700
KTNNAISSKREILRRLNENLKAQEDEKGKQNLSDTFEINVHEDAKEHEKEKSVSSDRKKWEAGGQLVIPL    701 - 770
DELTLDTSFSTTERHTVGEVIKLGPNGSPRRAWGKSPTDSVLKILGEAELQLQTELLENTTIRSEISPEG    771 - 840
EKYKPLITGEKKVQCISHEINPSAIVDSPVETKSPEFSEASPQMSLKLEGNLEEPDDLETEILQEPSGTN    841 - 910
KDESLPCTITDVWISEEKETKETQSADRITIQENEVSEDGVSSTVDQLSDIHIEPGTNDSQHSKCDVDKS    911 - 980
VQPEPFFHKVVHSEHLNLVPQVQSVQCSPEESFAFRSHSHLPPKNKNKNSLLIGLSTGLFDANNPKMLRT    981 - 1050
CSLPDLSKLFRTLMDVPTVGDVRQDNLEIDEIEDENIKEGPSDSEDIVFEETDTDLQELQASMEQLLREQ   1051 - 1120
PGEEYSEEEESVLKNSDVEPTANGTDVADEDDNPSSESALNEEWHSDNSDGEIASECECDSVFNHLEELR   1121 - 1190
LHLEQEMGFEKFFEVYEKIKAIHEDEDENIEICSKIVQNILGNEHQHLYAKILHLVMADGAYQEDNDE     1191 - 1258
//

Text Mined References (47)

PMID Year Title