Property Summary

NCBI Gene PubMed Count 39
PubMed Score 46.89
PubTator Score 38.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7933 6.1e-10
atypical teratoid / rhabdoid tumor 4369 5.3e-06
active Crohn's disease 918 2.4e-02
Disease Target Count Z-score Confidence
Colorectal adenoma 15 3.231 1.6

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -3.613 6.1e-10
atypical teratoid / rhabdoid tumor -1.200 5.3e-06
active Crohn's disease 1.036 2.4e-02

Gene RIF (26)

PMID Text
26751644 NEIL1 and NEIL2 cooperate with TDG during base excision: TDG occupies the abasic site and is displaced by NEILs, which further process the baseless sugar, thereby stimulating TDG-substrate turnover.
26601495 The variability of potentially important functional polymorphic variants of the IFNG, IFNGR2 and NEIL2 genes was characterized in representatives of four ethnic groups living in the Siberian region.
26554163 Studied six SNP loci: (rs2279115 of BCL2 gene, rs804270 of NEIL2 gene, rs909253 of LTA gene, rs2294008 of PSCA gene, rs3765524 and rs10509670 of PLCE1 gene) to evaluate gastric cancer risk using magnetic nanoparticles and universal tagged arrays.
26373042 variant alleles in the NEIL2 (rs804270), APE1 (rs2275008), CYP2E1 (rs2031920) and MDM2 (rs2279744) SNPs may independently influence susceptibility to gastric cancer in a Northern Jiangsu Chinese population.
24595271 data strongly suggest that decreased repair of oxidative DNA base lesions due to an impaired NEIL2 expression in non-smokers exposed to SSS would lead to accumulation of mutations in genomic DNA of lung cells over time
24406253 CSB protein stimulates NEIL2 DNA glycosylase activity
22497777 Results suggest that the decreased DNA repair capacity of the DNA glycosylase NEIL2 R257L variant can induce mutations that lead to lung cancer development.
22199273 REG4, BIRC5 and NEIL2 genes might have a role in the sensitivity of cancer patients to radiotherapy
22130663 the critical role of NEIL2 and PNKP in maintenance of the mammalian mitochondrial genome.
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20175991 the beta2/beta3 loop where Lys50 is located in NEIL2 is important for DNA binding, presumably lies next to a phosphate-binding site, and may represent a target for regulation of the enzyme activity.
18651651 in vivo variability in NEIL2 expression in humans identifies SNPs in the NEIL2 promoter region that have functional effects.
18594018 NEIL2, but not NEIL1, polymorphisms may have a role in risk and progression of squamous cell carcinomas of the oral cavity and oropharynx
18594018 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18515411 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17686777 YB-1 thus appears to have a novel regulatory role in NEIL2-mediated repair under oxidative stress.
17150535 The damage specificity of human homologues of Endo III (hNTHl) and Endo VIII (hNEIL1 and hNEIL2) is compared to elucidate the repair role in cells.
17029639 A novel missense variant C367A and several other mutations were found in familial colorectal cancer DNA suggesting a limited role for this gene in the devlopment of CRC.
16982218 results show that the NEIL2-initiated repair of 5-hydroxyuracil (5-OHU) requires polynucleotide kinase (PNK)
15339932 the zinc finger motif in NEIL2 is essential for its structural integrity and enzyme activity
15175427 Reversible acetylation of Lys49 could thus regulate the repair activity of NEIL2 in vivo
14734554 hNEIL2 recognized an apurinic/apyrimidinic site exclusively, and the activity for 5-hydroxyuracil and guanine-derived formamidopyrimidine was marginal
14522990 NEIL1 and NEIL2 are preferentially involved in repair of lesions in DNA bubbles generated during transcription and/or replication
12097317 NEIL2 is involved in global genome repair mainly for removing oxidative products of cytosine.

AA Sequence

MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPT      1 - 70
PEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGS     71 - 140
VWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEAL    141 - 210
GQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRP    211 - 280
QHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS                      281 - 332
//

Text Mined References (43)

PMID Year Title
26751644 2016 Neil DNA glycosylases promote substrate turnover by Tdg during DNA demethylation.
26601495 2015 [Characteristic of the Genetic Variability of Four Polymorphic Variants (rs2069705, rs17880053, rs11126176, and rs804271) in Representative Samples of Indigenous and Alien Populations of Siberia].
26554163 2015 Genetic Variation of BCL2 (rs2279115), NEIL2 (rs804270), LTA (rs909253), PSCA (rs2294008) and PLCE1 (rs3765524, rs10509670) Genes and Their Correlation to Gastric Cancer Risk Based on Universal Tagged Arrays and Fe3O4 Magnetic Nanoparticles.
26373042 2015 Polymorphisms in NEIL-2, APE-1, CYP2E1 and MDM2 Genes are Independent Predictors of Gastric Cancer Risk in a Northern Jiangsu Population (China).
25416956 2014 A proteome-scale map of the human interactome network.
24595271 2014 NEIL2 protects against oxidative DNA damage induced by sidestream smoke in human cells.
24406253 2014 Cockayne Syndrome group B protein stimulates NEIL2 DNA glycosylase activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23942779 2013 A genome-wide association study of behavioral disinhibition.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22497777 2012 Increased risk of lung cancer associated with a functionally impaired polymorphic variant of the human DNA glycosylase NEIL2.
22199273 2011 REG4, NEIL2, and BIRC5 gene expression correlates with gamma-radiation sensitivity in patients with rectal cancer receiving radiotherapy.
22130663 2012 Role of human DNA glycosylase Nei-like 2 (NEIL2) and single strand break repair protein polynucleotide kinase 3'-phosphatase in maintenance of mitochondrial genome.
21507922 2011 Duffy-null-associated low neutrophil counts influence HIV-1 susceptibility in high-risk South African black women.
20819778 2010 MicroRNA-related genetic variations as predictors for risk of second primary tumor and/or recurrence in patients with early-stage head and neck cancer.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20175991 2010 Inactivation of NEIL2 DNA glycosylase by pyridoxal phosphate reveals a loop important for substrate binding.
18651651 2008 Single nucleotide polymorphisms 5' upstream the coding region of the NEIL2 gene influence gene transcription levels and alter levels of genetic damage.
18594018 2008 Functional variants of the NEIL1 and NEIL2 genes and risk and progression of squamous cell carcinoma of the oral cavity and oropharynx.
18515411 2008 Inherited predisposition to colorectal adenomas caused by multiple rare alleles of MUTYH but not OGG1, NUDT1, NTH1 or NEIL 1, 2 or 3.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17686777 2007 Stimulation of NEIL2-mediated oxidized base excision repair via YB-1 interaction during oxidative stress.
17150535 2004 Damage specificity of human DNA glycosylases for oxidative pyrimidine lesions.
17029639 2006 Evaluation of NTHL1, NEIL1, NEIL2, MPG, TDG, UNG and SMUG1 genes in familial colorectal cancer predisposition.
16982218 2006 NEIL2-initiated, APE-independent repair of oxidized bases in DNA: Evidence for a repair complex in human cells.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16381901 2006 The LIFEdb database in 2006.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15339932 2004 Identification of a zinc finger domain in the human NEIL2 (Nei-like-2) protein.
15175427 2004 Acetylation of the human DNA glycosylase NEIL2 and inhibition of its activity.
14734554 2004 Differential specificity of human and Escherichia coli endonuclease III and VIII homologues for oxidative base lesions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522990 2003 Repair of oxidized bases in DNA bubble structures by human DNA glycosylases NEIL1 and NEIL2.
12509226 2002 A novel human DNA glycosylase that removes oxidative DNA damage and is homologous to Escherichia coli endonuclease VIII.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12200441 2002 A back-up glycosylase in Nth1 knock-out mice is a functional Nei (endonuclease VIII) homologue.
12097317 2002 Identification and characterization of a novel human DNA glycosylase for repair of cytosine-derived lesions.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11076863 2000 DNA cloning using in vitro site-specific recombination.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.