Property Summary

NCBI Gene PubMed Count 65
PubMed Score 101.09
PubTator Score 107.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.600 3.6e-04
osteosarcoma -1.185 9.1e-04
medulloblastoma -1.700 3.1e-06
atypical teratoid / rhabdoid tumor -1.500 5.2e-06
glioblastoma -1.400 5.8e-07
medulloblastoma, large-cell -1.700 5.2e-05
pediatric high grade glioma -1.300 6.5e-07
Breast cancer -1.800 1.1e-05
gastric carcinoma -1.100 9.1e-03

Protein-protein Interaction (1)

Gene RIF (59)

PMID Text
26751644 NEIL1 and NEIL2 cooperate with TDG during base excision: TDG occupies the abasic site and is displaced by NEILs, which further process the baseless sugar, thereby stimulating TDG-substrate turnover.
26134572 NEIL1 forms a multiprotein complex with DNA replication proteins via its C-terminal domain, allowing recruitment at the replication fork.
26095805 Findings suggesting that DNA glycosylase NEIL1 c.C844T is a defective allele.
26074017 first study to show that SNPs of genes involved in DNA repair, may modulate the risk of Depressive Disorder.
25873625 Rad9 regulates base excision repair by controlling NEIL1 transcription.
25605055 Results show that YB-1 interferes negatively with the AP site DNA cleavage activity of both APE1 and NEIL1 for ssDNA and bubble structures.
24382305 genome and cancer single nucleotide polymorphisms of the human NEIL1 DNA glycosylase
24022861 The NEIL1 rs4462560 SNP may serve as a predictor of acute RIET and RP risk but not of overall survival.
23926102 one role for Neil3 and NEIL1 is to repair DNA base damages in telomeres in vivo and that Neil3 and Neil1 may function in quadruplex-mediated cellular events, such as gene regulation via removal of damaged bases from quadruplex DNA.
23898192 Prereplicative repair of oxidized bases in the human genome is mediated by NEIL1 DNA glycosylase together with replication proteins.
23542007 Authors show that the intrinsically disordered C-terminal domain interacts with the folded domain in native NEIL1 containing 389 residues.
23508956 NEIL1 recognizes specifically and distinctly interstrand crosslinks in DNA, and can obstruct the efficient removal of lethal crosslink adducts.
23104860 binds to the BRCT domain of PARP-1
22902625 the hnRNP-U protection of cells after oxidative stress is largely due to enhancement of NEIL1-mediated repair.
22858590 Pro2 and Lys54 are involved in the AP lyase activity; Met81, Arg119 and Phe120 are essential for removal of 8-oxoG in duplex DNA
22639086 the binding of these modified DNAs with the unedited and edited forms of human NEIL1 along with E. coli Endo III
22465744 we demonstrated that hNEIL1 and hNTH1 cleave Oz sites as efficiently as 5-hydroxyuracil sites. Thus, hNEIL1 and hNTH1 can repair Oz lesions
22286769 aberrant promoter methylation of NEIL1 in head and neck squamous cell carcinoma
22170059 Structural characterization of viral ortholog of human DNA glycosylase NEIL1 bound to thymine glycol or 5-hydroxyuracil-containing DNA.
21985917 NEIL1 gene mutation may have a causative role in the development of type 2 diabetes in the Turkish population.
21697813 Homozygosity mapping and exome sequencing in a consanguineous kindred identified MYO1E and NEIL1 as novel candidate genes for human autosomal recessive steroid-resistant nephrotic syndrome.
21131780 These data suggest Neil1 may be a critical mediator of base excision repair of incorporated dUMP following thymidylate synthetase pathway inhibition.
21068368 NEIL1 recoding site is a preferred editing site for the RNA editing adenosine deaminase ADAR1.
20522537 Observational study of gene-disease association. (HuGE Navigator)
20496165 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20346739 WRN is the only human RecQ helicase that stimulates NEIL1 DNA glycosylase activity, and that this stimulation requires a double-stranded DNA substrate.
20338831 Modulation of NEIL1's activity on single-stranded DNA substrate by RPA and PCNA support NEIL1's involvement in repairing the replicating genome.
20099873 The results indicate that NEIL1 does not require a base opposite to identify and remove hydantoin lesions.
20005182 These results suggest that, in vivo, NEIL1 functions either at nucleosome-free regions (such as those near replication forks) or with cofactors that limit its non-specific binding to DNA.
19840299 enzymological activity in peripheral leukocytes is increased in children with asthma bronchiale
19443904 The NEIL1 G83D mutant was dysfunctional for the major oxidation products 7,8-dihydro-8-oxoguanine (8oxoG), thymine glycol and dihydrothymine in duplex DNA, and the ability to perform delta-elimination at abasic sites was significantly reduced.
19258314 a model for the mechanism of ICL repair in mammalian cells that implicates the DNA glycosylase activity of NEIL1 downstream of XPF/ERCC1 and translesion DNA synthesis repair steps.
19179336 Cockayne syndrome group B protein plays a role in repair of formamidopyrimidines, possibly by interacting with and stimulating NEIL1
19047128 Observational study of gene-disease association. (HuGE Navigator)
18662981 NEIL1 could also participate in strand displacement repair synthesis (long patch repair (LP-BER)) mediated by FEN-1 and stimulated by PCNA.
18594018 NEIL2, but not NEIL1, polymorphisms may have a role in risk and progression of squamous cell carcinomas of the oral cavity and oropharynx
18594018 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18543945 These results indicate that the hydantoin lesions are the best substrates identified thus far for hNEIL1 and suggest that repair of these lesions may be a critical function of the hNEIL1 enzyme in vivo.
18515411 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18155253 Observational study of gene-disease association. (HuGE Navigator)
18032376 human DNA glycosylase NEIL1 interacts with proliferating cell nuclear antigen and may have a role in replication-associated repair of oxidized bases
17611195 WRN participates in the same DNA repair pathway as NEIL1.
17556049 Centrosomal localization of hNEIL1 was observed when mitotic HeLa cells were immunostained with hNEIL1 antibodies
17432829 The ability of Neil1 to recognize a variety of pyrimidine lesions is connected to the flexible binding pocket of the enzyme and the common chemical features of lesions that contain a pyrimidine ring.
17395641 Human NEIL1 DNA glycosylase activity is significantly stimulated by hHus1, hRad1, hRad9 separately and by the 9-1-1 complex.
17348689 we found that although both SMUG1 and NEIL1 are able to excise 5-OHU lesions located in the proximity of the proximity of the 3'-end of a DNA SSB, NEIL1 is more efficient in the repair of these DNA lesions.
17150535 The damage specificity of human homologues of Endo III (hNTHl) and Endo VIII (hNEIL1 and hNEIL2) is compared to elucidate the repair role in cells.
17029639 A T434+2C mutation was found in familial colorectal cancer DNA suggesting a limited role for this gene in the devlopment of CRC.
16446124 Nth1 released 5R,6S 2'-deoxyribonucleoside diastereoisomer (Tg2) much more rapidly than cis 5S,6R-deoxyribonucleoside diastereoisomer (Tg1) regardless of the opposing purine. Neil1 released Thymine glycol non-stereoselectively.
16118226 Oxidative stress-induced activation of NEIL1 appears to be involved in the feedback regulation of cellular repair activity needed to handle an increase in the level of oxidative base damage
15533839 NEIL1 is a DNA glycosylase that excise 5-formyluracil, 5-hydroxymethyluracil and Thymine glycol in human cells.
15350146 NEIL1 and OGG1, two DNA glycosylases which do not stably interact with each other, stimulate 8-oxoguanine repair by a collaboration that is possible because of higher abasic (AP) site affinity and stronger AP lyase activity of NEIL1 relative to OGG1.
15319300 Reduced expression of NEIL1 is associated with the pathogenesis of gastric cancers
15232006 "zincless finger" appears to be required for NEIL1 activity, because mutating a very highly conserved arginine within this motif greatly reduces the glycosylase activity of the enzyme.
15159582 Overproduction, crystallization and preliminary crystallographic analysis of NEIL1
14734554 hNEIL1 has a significant role in the repair of 5S-Tg in human cells.
14522990 NEIL1 and NEIL2 are preferentially involved in repair of lesions in DNA bubbles generated during transcription and/or replication
12509226 Pyrimidine dimer repair enzyme located on the long arm of chromosome 15 that is frequently deleted in human cancers.
12433996 hFPG1 and hFPG2 repair 8-oxoguanine and other DNA oxidation products. (hFPG1 and hFPG2)

AA Sequence

MPEGPELHLASQFVNEACRALVFGGCVEKSSVSRNPEVPFESSAYRISASARGKELRLILSPLPGAQPQQ      1 - 70
EPLALVFRFGMSGSFQLVPREELPRHAHLRFYTAPPGPRLALCFVDIRRFGRWDLGGKWQPGRGPCVLQE     71 - 140
YQQFRENVLRNLADKAFDRPICEALLDQRFFNGIGNYLRAEILYRLKIPPFEKARSVLEALQQHRPSPEL    141 - 210
TLSQKIRTKLQNPDLLELCHSVPKEVVQLGGKGYGSESGEEDFAAFRAWLRCYGMPGMSSLQDRHGRTIW    211 - 280
FQGDPGPLAPKGRKSRKKKSKATQLSPEDRVEDALPPSKAPSRTRRAKRDLPKRTATQRPEGTSLQQDPE    281 - 350
APTVPKKGRRKGRQAASGHCRPRKVKADIPSLEPEGTSAS                                  351 - 390
//

Text Mined References (66)

PMID Year Title
26751644 2016 Neil DNA glycosylases promote substrate turnover by Tdg during DNA demethylation.
26134572 2015 The C-terminal Domain (CTD) of Human DNA Glycosylase NEIL1 Is Required for Forming BERosome Repair Complex with DNA Replication Proteins at the Replicating Genome: DOMINANT NEGATIVE FUNCTION OF THE CTD.
26095805 2015 NEIL1 p.Gln282Stop variant is predominantly localized in the cytoplasm and exhibits reduced activity in suppressing mutations.
26074017 2015 Association between single nucleotide polymorphisms of MUTYH, hOGG1 and NEIL1 genes, and depression.
25873625 2015 Regulation of NEIL1 protein abundance by RAD9 is important for efficient base excision repair.
25605055 2015 Inhibition of abasic site cleavage in bubble DNA by multifunctional protein YB-1.
24382305 2014 Genome and cancer single nucleotide polymorphisms of the human NEIL1 DNA glycosylase: activity, structure, and the effect of editing.
24022861 2013 A NEIL1 single nucleotide polymorphism (rs4462560) predicts the risk of radiation-induced toxicities in esophageal cancer patients treated with definitive radiotherapy.
23926102 2013 Neil3 and NEIL1 DNA glycosylases remove oxidative damages from quadruplex DNA and exhibit preferences for lesions in the telomeric sequence context.
23898192 2013 Prereplicative repair of oxidized bases in the human genome is mediated by NEIL1 DNA glycosylase together with replication proteins.
23542007 2013 The disordered C-terminal domain of human DNA glycosylase NEIL1 contributes to its stability via intramolecular interactions.
23508956 2013 NEIL1 responds and binds to psoralen-induced DNA interstrand crosslinks.
23104860 2012 Coordination of DNA repair by NEIL1 and PARP-1: a possible link to aging.
22902625 2012 Enhancement of NEIL1 protein-initiated oxidized DNA base excision repair by heterogeneous nuclear ribonucleoprotein U (hnRNP-U) via direct interaction.
22858590 2012 Biochemical mapping of human NEIL1 DNA glycosylase and AP lyase activities.
22639086 2012 NEIL1 binding to DNA containing 2'-fluorothymidine glycol stereoisomers and the effect of editing.
22465744 2012 A DNA oligomer containing 2,2,4-triamino-5(2H)-oxazolone is incised by human NEIL1 and NTH1.
22286769 2012 Epigenetic screen of human DNA repair genes identifies aberrant promoter methylation of NEIL1 in head and neck squamous cell carcinoma.
22170059 2012 Structural characterization of viral ortholog of human DNA glycosylase NEIL1 bound to thymine glycol or 5-hydroxyuracil-containing DNA.
21985917 2012 Prevalence of the DNA repair enzyme-NEIL1 gene mutation in patients with type 2 diabetes in the Turkish population.
21697813 2011 Exome sequencing identified MYO1E and NEIL1 as candidate genes for human autosomal recessive steroid-resistant nephrotic syndrome.
21131780 2010 Phenotypic enhancement of thymidylate synthetase pathway inhibitors following ablation of Neil1 DNA glycosylase/lyase.
21068368 2010 RNA editing changes the lesion specificity for the DNA repair enzyme NEIL1.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
20496165 2011 Comprehensive screen of genetic variation in DNA repair pathway genes and postmenopausal breast cancer risk.
20346739 2010 Substrate specific stimulation of NEIL1 by WRN but not the other human RecQ helicases.
20338831 2010 RPA physically interacts with the human DNA glycosylase NEIL1 to regulate excision of oxidative DNA base damage in primer-template structures.
20099873 2010 Mutation versus repair: NEIL1 removal of hydantoin lesions in single-stranded, bulge, bubble, and duplex DNA contexts.
20005182 2010 Non-specific DNA binding interferes with the efficient excision of oxidative lesions from chromatin by the human DNA glycosylase, NEIL1.
19840299 2010 DNA damage and glutathione level in children with asthma bronchiale: effect of antiasthmatic therapy.
19443904 2009 Catalytically impaired hMYH and NEIL1 mutant proteins identified in patients with primary sclerosing cholangitis and cholangiocarcinoma.
19258314 2009 The human oxidative DNA glycosylase NEIL1 excises psoralen-induced interstrand DNA cross-links in a three-stranded DNA structure.
19179336 2009 Cockayne syndrome group B protein stimulates repair of formamidopyrimidines by NEIL1 DNA glycosylase.
19047128 2008 Single nucleotide polymorphisms of microRNA machinery genes modify the risk of renal cell carcinoma.
18662981 2008 Physical and functional interaction between human oxidized base-specific DNA glycosylase NEIL1 and flap endonuclease 1.
18594018 2008 Functional variants of the NEIL1 and NEIL2 genes and risk and progression of squamous cell carcinoma of the oral cavity and oropharynx.
18543945 2008 Superior removal of hydantoin lesions relative to other oxidized bases by the human DNA glycosylase hNEIL1.
18515411 2008 Inherited predisposition to colorectal adenomas caused by multiple rare alleles of MUTYH but not OGG1, NUDT1, NTH1 or NEIL 1, 2 or 3.
18155253 2008 OGG1 expression and OGG1 Ser326Cys polymorphism and risk of lung cancer in a prospective study.
18032376 2008 Interaction of the human DNA glycosylase NEIL1 with proliferating cell nuclear antigen. The potential for replication-associated repair of oxidized bases in mammalian genomes.
17611195 2007 The human Werner syndrome protein stimulates repair of oxidative DNA base damage by the DNA glycosylase NEIL1.
17556049 2007 Human NEIL1 localizes with the centrosomes and condensed chromosomes during mitosis.
17432829 2007 Lesion specificity in the base excision repair enzyme hNeil1: modeling and dynamics studies.
17395641 2007 The human checkpoint sensor Rad9-Rad1-Hus1 interacts with and stimulates NEIL1 glycosylase.
17348689 2007 NEIL1 is the major DNA glycosylase that processes 5-hydroxyuracil in the proximity of a DNA single-strand break.
17150535 2004 Damage specificity of human DNA glycosylases for oxidative pyrimidine lesions.
17029639 2006 Evaluation of NTHL1, NEIL1, NEIL2, MPG, TDG, UNG and SMUG1 genes in familial colorectal cancer predisposition.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
16446124 2006 Repair of thymine glycol by hNth1 and hNeil1 is modulated by base pairing and cis-trans epimerization.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16118226 2005 Induction of the human oxidized base-specific DNA glycosylase NEIL1 by reactive oxygen species.
15533839 2005 DNA glycosylase activities for thymine residues oxidized in the methyl group are functions of the hNEIL1 and hNTH1 enzymes in human cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15350146 2004 Stimulation of DNA glycosylase activity of OGG1 by NEIL1: functional collaboration between two human DNA glycosylases.
15319300 2004 Inactivating mutations of the human base excision repair gene NEIL1 in gastric cancer.
15260972 2004 AP endonuclease-independent DNA base excision repair in human cells.
15232006 2004 The crystal structure of human endonuclease VIII-like 1 (NEIL1) reveals a zincless finger motif required for glycosylase activity.
15159582 2004 Overproduction, crystallization and preliminary crystallographic analysis of a novel human DNA-repair enzyme that recognizes oxidative DNA damage.
14734554 2004 Differential specificity of human and Escherichia coli endonuclease III and VIII homologues for oxidative base lesions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14522990 2003 Repair of oxidized bases in DNA bubble structures by human DNA glycosylases NEIL1 and NEIL2.
12509226 2002 A novel human DNA glycosylase that removes oxidative DNA damage and is homologous to Escherichia coli endonuclease VIII.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12433996 2002 Human DNA glycosylases of the bacterial Fpg/MutM superfamily: an alternative pathway for the repair of 8-oxoguanine and other oxidation products in DNA.
12200441 2002 A back-up glycosylase in Nth1 knock-out mice is a functional Nei (endonuclease VIII) homologue.
11904416 2002 Identification and characterization of a human DNA glycosylase for repair of modified bases in oxidatively damaged DNA.