Property Summary

NCBI Gene PubMed Count 49
PubMed Score 129.11
PubTator Score 35.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
astrocytoma -2.500 2.8e-17
posterior fossa group A ependymoma -2.600 2.0e-12
oligodendroglioma -2.800 3.7e-14
glioblastoma -3.900 5.7e-04
medulloblastoma -3.100 1.5e-06
cystic fibrosis -1.012 7.6e-03
atypical teratoid / rhabdoid tumor -2.200 3.4e-05
medulloblastoma, large-cell -3.600 1.6e-03
primitive neuroectodermal tumor -2.100 5.4e-04
Atopic dermatitis -2.400 8.6e-04
adrenocortical carcinoma -1.620 2.7e-09
non-small cell lung cancer -1.582 7.2e-16
intraductal papillary-mucinous adenoma (... -2.100 1.6e-02
intraductal papillary-mucinous carcinoma... -2.700 9.5e-03
intraductal papillary-mucinous neoplasm ... -2.900 2.3e-02
lung adenocarcinoma -1.200 6.6e-14
adult high grade glioma -4.000 7.3e-05
pilocytic astrocytoma -1.700 7.8e-06
aldosterone-producing adenoma -1.035 2.0e-02
psoriasis -1.300 4.1e-05
Pick disease -1.600 1.3e-03
ductal carcinoma in situ -1.700 1.6e-02
invasive ductal carcinoma -2.600 5.4e-03
ovarian cancer -2.400 2.2e-16
pituitary cancer 1.500 3.3e-03
head and neck cancer -2.100 6.7e-03

Gene RIF (31)

PMID Text
25640768 Genetic variants associated with BMI and WHR in adults influence growth patterns and general and abdominal fat development from early childhood onwards.
25370040 We observed novel selection signals in CDKAL1 and NEGR1, well-known diabetes and obesity susceptibility genes
25245582 NEGR1 could be an important locus influencing certain personality dimensions in BN patients.
25072390 First study to find an association between an obesity risk gene and differences in white matter integrity. As our subjects were young and healthy, our results suggest that NEGR1 has effects on brain structure independent of its effect on obesity.
23950990 Data indicate strong associations with severe obesity for single nucleotide polymorphism (SNP) rs9939609 within the FTO gene and SNP rs2815752 near the NEGR1 gene.
23229156 Results imply a regulatory role for TMEM18, BDNF, MTCH2 and NEGR1 in adipocyte differentiation and biology. In addition, we show a variation of MAF expression during adipogenesis, while NPC1, PTER and SH2B1 were not regulated.
22443470 Our study supports earlier reports of SH2B1 to be of importance in insulin sensitivity and, in addition, suggests potential roles of NEGR1 and MTCH2.
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
22179955 Gene-treatment interactions were observed for long-term (NEGR1 rs2815752, Pmetformin*SNP = 0.028; FTO rs9939609, Plifestyle*SNP = 0.044) weight loss.
21750520 Meta-analysis of 4992 subjects revealed seven SNPs near four loci, including NEGR1, TMEM18, SH2B1 /ATP2A1 and MC4R, showing significant association at 0.005
21624008 The results of these studies provide supporting evidence for MYEOV and NEGR1 as gene targets of 11q13 gains and 1p31 deletions in a neuroblastoma subset.
21427694 Data suggest that in addition to its reported role in the brain, NEGR1 is also expressed in subcutaneous adipose tissue and acts as a central 'hub' in an obesity-related transcript network.
20816195 Observational study of gene-disease association. (HuGE Navigator)
20816152 Observational study of gene-disease association. (HuGE Navigator)
20725061 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20724581 Observational study of gene-disease association. (HuGE Navigator)
20712903 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20571754 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20520848 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20386550 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20215397 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19910938 Observational study of gene-disease association. (HuGE Navigator)
19851340 Observational study of gene-disease association. (HuGE Navigator)
19812171 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19746409 Observational study of gene-disease association. (HuGE Navigator)
19692490 Observational study of gene-disease association. (HuGE Navigator)
19164386 Observational study of gene-disease association. (HuGE Navigator)
19079261 Observational study, meta-analysis, and genome-wide association study of gene-disease association. (HuGE Navigator)

AA Sequence

MDMMLLVQGACCSNQWLAAVLLSLCCLLPSCLPAGQSVDFPWAAVDNMMVRKGDTAVLRCYLEDGASKGA      1 - 70
WLNRSSIIFAGGDKWSVDPRVSISTLNKRDYSLQIQNVDVTDDGPYTCSVQTQHTPRTMQVHLTVQVPPK     71 - 140
IYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPSAKPFENGQYLDIYGITRDQAGEYECSAENDVS    141 - 210
FPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLIRCEGAGVPPPAFEWYKGEKKLFNGQQGIIIQNFSTRS    211 - 280
ILTVTNVTQEHFGNYTCVAANKLGTTNASLPLNPPSTAQYGITGSADVLFSCWYLVLTLSSFTSIFYLKN    281 - 350
AILQ                                                                      351 - 354
//

Text Mined References (51)

PMID Year Title
25640768 2015 Adult adiposity susceptibility loci, early growth and general and abdominal fatness in childhood: the Generation R Study.
25370040 2015 Novel genomic signals of recent selection in an Ethiopian population.
25245582 2015 Impact of NEGR1 genetic variability on psychological traits of patients with eating disorders.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25072390 2014 Obesity gene NEGR1 associated with white matter integrity in healthy young adults.
23950990 2013 Contribution of 32 GWAS-identified common variants to severe obesity in European adults referred for bariatric surgery.
23669352 2013 Genome-wide analysis of BMI in adolescents and young adults reveals additional insight into the effects of genetic loci over the life course.
23563609 2013 Genome-wide SNP and CNV analysis identifies common and low-frequency variants associated with severe early-onset obesity.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23229156 2013 Functional relevance of genes implicated by obesity genome-wide association study signals for human adipocyte biology.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22443470 2012 The role of obesity-related genetic loci in insulin sensitivity.
22360420 2012 Proteomic analysis identifies dysfunction in cellular transport, energy, and protein metabolism in different brain regions of atypical frontotemporal lobar degeneration.
22179955 2012 Genetic predictors of weight loss and weight regain after intensive lifestyle modification, metformin treatment, or standard care in the Diabetes Prevention Program.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21750520 2012 Implication of European-derived adiposity loci in African Americans.
21624008 2011 Aberrations of NEGR1 on 1p31 and MYEOV on 11q13 in neuroblastoma.
21427694 2012 Differential coexpression analysis of obesity-associated networks in human subcutaneous adipose tissue.
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
20816195 2010 Analyses of shared genetic factors between asthma and obesity in children.
20816152 2010 Obesity and diabetes genetic variants associated with gestational weight gain.
20725061 2011 MC4R variant is associated with BMI but not response to resistance training in young females.
20724581 2010 Genetic susceptibility to obesity and related traits in childhood and adolescence: influence of loci identified by genome-wide association studies.
20712903 2010 Obesity and diabetes genes are associated with being born small for gestational age: results from the Auckland Birthweight Collaborative study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20571754 2010 Evaluating the discriminative power of multi-trait genetic risk scores for type 2 diabetes in a northern Swedish population.
20520848 2010 Genetic markers of adult obesity risk are associated with greater early infancy weight gain and growth.
20386550 2010 Genes and lifestyle factors in obesity: results from 12,462 subjects from MONICA/KORA.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20215397 2010 Implication of genetic variants near NEGR1, SEC16B, TMEM18, ETV5/DGKG, GNPDA2, LIN7C/BDNF, MTCH2, BCDIN3D/FAIM2, SH2B1, FTO, MC4R, and KCTD15 with obesity and type 2 diabetes in 7705 Chinese.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19910938 2010 Novel obesity risk loci do not determine distribution of body fat depots: a whole-body MRI/MRS study.
19851340 2009 Association between obesity and polymorphisms in SEC16B, TMEM18, GNPDA2, BDNF, FAIM2 and MC4R in a Japanese population.
19812171 2010 Cumulative effects and predictive value of common obesity-susceptibility variants identified by genome-wide association studies.
19746409 2010 Are recently identified genetic variants regulating BMI in the general population associated with anorexia nervosa?
19692490 2009 Obesity genes identified in genome-wide association studies are associated with adiposity measures and potentially with nutrient-specific food preference.
19164386 2009 Replication and extension of genome-wide association study results for obesity in 4923 adults from northern Sweden.
19079261 2009 Six new loci associated with body mass index highlight a neuronal influence on body weight regulation.
19079260 2009 Genome-wide association yields new sequence variants at seven loci that associate with measures of obesity.
18204098 2008 Association of systemic lupus erythematosus with C8orf13-BLK and ITGAM-ITGAX.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17903294 2007 Genome-wide association and linkage analyses of hemostatic factors and hematological phenotypes in the Framingham Heart Study.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16602701 2006 Modification-specific proteomics of plasma membrane proteins: identification and characterization of glycosylphosphatidylinositol-anchored proteins released upon phospholipase D treatment.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10075727 1999 Characterization of a novel rat brain glycosylphosphatidylinositol-anchored protein (Kilon), a member of the IgLON cell adhesion molecule family.