Property Summary

NCBI Gene PubMed Count 38
PubMed Score 344.05
PubTator Score 124.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -5.400 6.2e-08
astrocytic glioma -4.500 3.9e-03
Astrocytoma, Pilocytic -5.100 9.1e-11
atypical teratoid / rhabdoid tumor -4.700 5.8e-09
colon cancer -1.400 1.1e-04
cystic fibrosis 1.452 1.4e-03
Down syndrome -1.100 3.8e-02
ependymoma -6.000 1.0e-03
glioblastoma -4.400 4.3e-08
group 4 medulloblastoma -6.200 1.3e-11
lung carcinoma 1.600 1.2e-07
malignant mesothelioma 2.800 4.2e-06
oligodendroglioma -3.600 2.0e-02
periodontitis -1.300 2.0e-28
Pick disease -2.200 2.7e-02
pituitary cancer -1.500 4.2e-02
severe Alzheimer's disease -1.725 3.5e-02

Gene RIF (19)

AA Sequence

MSYTLDSLGNPSAYRRVTETRSSFSRVSGSPSSGFRSQSWSRGSPSTVSSSYKRSMLAPRLAYSSAMLSS      1 - 70
AESSLDFSQSSSLLNGGSGPGGDYKLSRSNEKEQLQGLNDRFAGYIEKVHYLEQQNKEIEAEIQALRQKQ     71 - 140
ASHAQLGDAYDQEIRELRATLEMVNHEKAQVQLDSDHLEEDIHRLKERFEEEARLRDDTEAAIRALRKDI    141 - 210
EEASLVKVELDKKVQSLQDEVAFLRSNHEEEVADLLAQIQASHITVERKDYLKTDISTALKEIRSQLESH    211 - 280
SDQNMHQAEEWFKCRYAKLTEAAEQNKEAIRSAKEEIAEYRRQLQSKSIELESVRGTKESLERQLSDIEE    281 - 350
RHNHDLSSYQDTIQQLENELRGTKWEMARHLREYQDLLNVKMALDIEIAAYRKLLEGEETRFSTFAGSIT    351 - 420
GPLYTHRPPITISSKIQKPKVEAPKLKVQHKFVEEIIEETKVEDEKSEMEEALTAITEELAVSMKEEKKE    421 - 490
AAEEKEEEPEAEEEEVAAKKSPVKATAPEVKEEEGEKEEEEGQEEEEEEDEGAKSDQAEEGGSEKEGSSE    491 - 560
KEEGEQEEGETEAEAEGEEAEAKEEKKVEEKSEEVATKEELVADAKVEKPEKAKSPVPKSPVEEKGKSPV    561 - 630
PKSPVEEKGKSPVPKSPVEEKGKSPVPKSPVEEKGKSPVSKSPVEEKAKSPVPKSPVEEAKSKAEVGKGE    631 - 700
QKEEEEKEVKEAPKEEKVEKKEEKPKDVPEKKKAESPVKEEAVAEVVTITKSVKVHLEKETKEEGKPLQQ    701 - 770
EKEKEKAGGEGGSEEEGSDKGAKGSRKEDIAVNGEVEGKEEVEQETKEKGSGREEEKGVVTNGLDLSPAD    771 - 840
EKKGGDKSEEKVVVTKTVEKITSEGGDGATKYITKSVTVTQKVEEHEETFEEKLVSTKKVEKVTSHAIVK    841 - 910
EVTQSD                                                                    911 - 916
//

Text Mined References (45)

PMID Year Title