Property Summary

NCBI Gene PubMed Count 61
PubMed Score 581.88
PubTator Score 232.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.400 3.3e-03
aldosterone-producing adenoma -1.148 8.1e-03
astrocytic glioma -3.000 3.5e-03
Astrocytoma, Pilocytic -2.700 3.2e-07
atypical teratoid / rhabdoid tumor -2.300 3.5e-07
cystic fibrosis 1.340 6.6e-05
Down syndrome -1.400 1.8e-02
ependymoma -2.000 5.9e-03
fibroadenoma 1.900 2.2e-02
glioblastoma -2.300 3.4e-06
group 3 medulloblastoma -2.800 3.1e-03
malignant mesothelioma 4.800 1.4e-09
oligodendroglioma -1.900 1.8e-10
ovarian cancer -1.300 2.2e-02
Pick disease -1.100 2.6e-02
pituitary cancer -1.900 1.0e-04
primitive neuroectodermal tumor -1.800 2.1e-03
severe Alzheimer's disease -1.524 4.4e-02

Gene RIF (38)

AA Sequence

MMSFGGADALLGAPFAPLHGGGSLHYALARKGGAGGTRSAAGSSSGFHSWTRTSVSSVSASPSRFRGAGA      1 - 70
ASSTDSLDTLSNGPEGCMVAVATSRSEKEQLQALNDRFAGYIDKVRQLEAHNRSLEGEAAALRQQQAGRS     71 - 140
AMGELYEREVREMRGAVLRLGAARGQLRLEQEHLLEDIAHVRQRLDDEARQREEAEAAARALARFAQEAE    141 - 210
AARVDLQKKAQALQEECGYLRRHHQEEVGELLGQIQGSGAAQAQMQAETRDALKCDVTSALREIRAQLEG    211 - 280
HAVQSTLQSEEWFRVRLDRLSEAAKVNTDAMRSAQEEITEYRRQLQARTTELEALKSTKDSLERQRSELE    281 - 350
DRHQADIASYQEAIQQLDAELRNTKWEMAAQLREYQDLLNVKMALDIEIAAYRKLLEGEECRIGFGPIPF    351 - 420
SLPEGLPKIPSVSTHIKVKSEEKIKVVEKSEKETVIVEEQTEETQVTEEVTEEEEKEAKEEEGKEEEGGE    421 - 490
EEEAEGGEEETKSPPAEEAASPEKEAKSPVKEEAKSPAEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKS    491 - 560
PPEAKSPEKEEAKSPAEVKSPEKAKSPAKEEAKSPAEAKSPEKAKSPVKEEAKSPAEAKSPVKEEAKSPA    561 - 630
EVKSPEKAKSPTKEEAKSPEKAKSPEKAKSPEKEEAKSPEKAKSPVKAEAKSPEKAKSPVKAEAKSPEKA    631 - 700
KSPVKEEAKSPEKAKSPVKEEAKSPEKAKSPVKEEAKTPEKAKSPVKEEAKSPEKAKSPEKAKTLDVKSP    701 - 770
EAKTPAKEEARSPADKFPEKAKSPVKEEVKSPEKAKSPLKEDAKAPEKEIPKKEEVKSPVKEEEKPQEVK    771 - 840
VKEPPKKAEEEKAPATPKTEEKKDSKKEEAPKKEAPKPKVEEKKEPAVEKPKESKVEAKKEEAEDKKKVP    841 - 910
TPEKEAPAKVEVKEDAKPKEKTEVAKKEPDDAKAKEPSKPAEKKEAAPEKKDTKEEKAKKPEEKPKTEAK    911 - 980
AKEDDKTLSKEPSKPKAEKAEKSSSTDQKDSKPPEKATEDKAAKGK                            981 - 1026
//

Text Mined References (64)

PMID Year Title