Property Summary

NCBI Gene PubMed Count 135
PubMed Score 312.71
PubTator Score 196.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
interstitial lung disease -1.400 1.2e-02
Multiple myeloma 1.488 2.1e-02
malignant mesothelioma -1.500 8.1e-07
astrocytoma -2.100 1.1e-19
ependymoma -2.700 4.7e-12
oligodendroglioma -2.100 7.7e-14
psoriasis -2.700 7.9e-04
glioblastoma -2.800 7.1e-05
cystic fibrosis 1.347 4.8e-05
atypical teratoid / rhabdoid tumor -2.700 2.7e-03
medulloblastoma -1.300 1.3e-02
medulloblastoma, large-cell -1.900 2.3e-04
ulcerative colitis -1.800 4.9e-04
adrenocortical carcinoma -1.366 1.6e-05
non-small cell lung cancer -2.598 5.3e-25
lung cancer -2.700 2.1e-04
colon cancer -2.000 3.2e-03
interstitial cystitis -3.400 1.0e-05
lung adenocarcinoma -2.500 5.0e-17
pediatric high grade glioma -2.300 1.7e-05
pilocytic astrocytoma -4.100 1.3e-10
Breast cancer -2.500 2.2e-07
spina bifida -1.531 4.5e-02
ductal carcinoma in situ -1.200 3.3e-02
invasive ductal carcinoma -1.500 2.1e-02
ovarian cancer -2.500 8.8e-13

Gene RIF (103)

PMID Text
26740304 Overexpression of Nedd4-2 enhanced hOAT4 ubiquitination, and inhibited hOAT4 transport activity.
26608079 Propose regulation of placental SNAT2/LAT1 ubiquitination by mTORC1 and Nedd4-2.
26363003 Data show that membrane protein Ndfip1 recruits E3 ubiquitin (Ub) ligase Nedd4-2 to the Golgi to target ether-a-go-go-related gene (hERG) channel for degradation while membrane protein Ndfip2 also mediates Nedd4-2 interaction with hERG in the Golgi.
26130719 DDB2 can bind to the promoter region of NEDD4L and recruit enhancer of zeste homolog 2 histone methyltransferase to repress NEDD4L transcription by enhancing histone H3 lysine 27 trimethylation at the NEDD4L promoter.
25785312 Proteomics analysis of EV71-infected cells reveals the involvement of host protein NEDD4L in EV71 replication.
25633977 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
25542253 Our results suggest that three screened NEDD4-2 variants do not play a leading role in the pathogenesis of photosensitive epilepsy in the Turkish population.
25295397 The mechanisms of activation and degradation of the NEDD4L:the transition from the closed to the active form is regulated by a competition of inositol 1,4,5-trisphosphate and Ca2+.
24831004 Human NHE3, but not non-primates NHE3s, is ubiquitinated by Nedd4-2.
24657276 glucocorticoid stimulation therefore appears to allow cAMP-dependent control of Na(+) absorption by facilitating the effects of PKA upon the Nedd4-2
24456330 Nedd4L expression may be increased to facilitate tumour growth in many melanomas.
24451387 Nedd4-2 plays an important role in the regulation of HCN1 trafficking and may compete with TRIP8b(1a-4) in this process
24446284 rs2288775 was significantly associated with metabolic syndrome x in female Kazakh in China.
24373531 NEDD4L-rs12606138 and rs8094327 are risk factors for dyslexia in a German cohort.
24312311 NEDD4L may play a tumor suppressive role in colorectal cancer
24284497 The NEDD4L salt sensitivity-associated genotype was associated with higher blood pressure, which may translate into increased risk for CVD morbidity and mortality.
24214981 PI3K-SGK1 pathway stabilizes Kv7.1 surface expression by inhibiting Nedd4-2-dependent endocytosis and thereby demonstrates that Nedd4-2 is a key regulator of Kv7.1 localization and turnover in epithelial cells.
24047422 Genetic variation in NEDD4L may have sex-dependent effects in the development of essential hypertension in Han Chinese
23895345 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
23812770 Low NEDD4L expression is associated with non-small cell lung cancer.
23792956 Data indicate that Rab4 regulates ether-a-go-go-related gene (hERG) channel density via neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2).
23594824 WNK4 inhibits ENaC channel activity independently of Nedd4-2-mediated ENaC ubiquitination.
23589291 SGK1,3 enhances the expression level of mature hERG channels by inhibiting Nedd4-2 as well as by promoting Rab11-mediated hERG recycling.
23549273 These results suggested that the functional variant of NEDD4L, rs4149601, may be associated with obesity and related phenotypes, and further genetic and functional studies are required to understand its role in the manifestation of obesity.
23396981 NEDD4L is a negative feedback regulator of Wnt signaling.
23353631 NEDD4L rs4149601, rs292449 and rs75982813 may be predictors for blood pressure response to hydrochlorothiazide in whites, and NEDD4L rs4149601 may be a predictor for adverse cardiovascular outcomes in whites not treated with hydrochlorothiazide
23305486 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
23262292 Understanding of the contribution of Nedd4 and Nedd4-2 in regulating key functions in the brain is shedding new light on the ubiquitination signal not only in orchestrating degradation events but also in protein trafficking
22957059 CNP12587 region, overlapping NEDD4L, may have a role in underlying height variation in Chinese females
22904170 Nedd4-2 does not ubiquitinate and thereby regulate wt-CFTR in human airway epithelial cells.
22879586 hERG expression in the plasma membrane is regulated by Cav3 via Nedd4-2
22505712 GLT-1 endocytosis is independent of its phosphorylation and that Nedd4-2 mediates PKC-dependent down-regulation of the transporter.
22385262 Three members of Nedd4 (neural-precursor-cell-expressed developmentally down-regulated)-like ubiquitin E3 ligases, Nedd4, Nedd4-2 and Itch were identified, as the ubiquitin E3 ligases for the long isoform of AMOT, AMOT/p130.
22361880 Nedd4-2 mediated ubiquitination regulates the cell surface expression of CHT1 in HEK293 cells.
22217575 expression of Nedd4L is down-regulated in human gliomas.
22190034 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
21909941 Our results suggest for the first time that negative Nedd4L expression is strongly related to the invasion and metastasis of gastric cancer
21900244 Neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2) regulation by 14-3-3 protein binding at canonical serum and glucocorticoid kinase 1 (SGK1) phosphorylation sites.
21852580 stimulated NCC ubiquitylation at the surface of transfected HEK293 cells
21762798 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
21478478 the data support the conclusion that Usp2-45 action on epithelial Na(+) channel is promoted by various interactions, including through binding to Nedd4-2
21176637 D-C-G-G haplotype of NEDD4L but not rs4149601 polymorphism was linked with hypertension in Kazakh.
21159863 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
21154329 genetic variations of the NEDD4L gene may be associated with obesity in Xinjiang Kazakh general population
21088674 Combining gene expression profiling and linkage analysis identified NEDD4L as a candidate gene involved in regulating sodium lithium countertransport activity.
21052022 NEDD4L rs4149601 polymorphism influences the efficacy of beta-blocker and/or diuretic-based antihypertensive treatment both in terms of blood pressure reduction and cardiovascular disease protection.
21052022 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
21039987 Over-expression of Nedd4L might lead to gallbladder cancer invasion by regulating the transcription of the MMP-1 and MMP-13 genes.
20862313 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
20675381 Nedd4-2 induces binding of ENaC to Hrs, which mediates the sorting decision between ENaC degradation and recycling.
20504882 Nedd4-2 interacts with occludin to inhibit tight junction assembly and the regulation of paracellular conductance in the collecting duct.
20466724 analysis of phosphorylatable residues that activate Nedd4-2 and may work together with residues targeted by inhibitory kinases (SGK1 and protein kinase A) to govern Nedd4-2 regulation of epithelial ion transport
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20090362 the role of NEDD4L-mediated ubiquitination in the pathogenesis of hypertension is disscussed
20064473 Results describe the crystal structure of a complex between the HECT domain of NEDD4L and the E2 UbcH5B bearing a covalently linked Ub at its active site (UbcH5B approximately Ub).
20051513 role of WW3 and WW4 domains of Nedd4-2 in dopamine transporter ubiquitination was demonstrated; siRNA analysis demonstrated that this polyubiquitination is mediated by Nedd4-2 cooperation with UBE2D and UBE2L3 E2 ubiquitin-conjugating enzymes
20003179 two common SNPs of NEDD4L (296921-296923delTTG and rs2288775), were found to be associated with essential hypertension in Kazakh females
20003179 Observational study of gene-disease association. (HuGE Navigator)
19953087 Although several substrates were recognized by both Nedd4-1 and Nedd4-2, others were specific to only one, with several Tyr kinases preferred by Nedd4-1 and some ion channels by Nedd4-
19917253 Results identify Nedd4L as the ubiquitin ligase in TGF-beta induced phosphorylation of the transcription factors Smad2 and Smad3.
19706893 Nedd4-2 is an E3 ligase recruited by Ndfip1 for the ubiquitination of DMT1 within human neurons.
19690890 Observational study of gene-disease association. (HuGE Navigator)
19664597 NPC2 binds C2 domain of human Nedd4L.
19635985 The A allele of NEDD4L may be a useful marker for predicting hypertension, orthostatic hypotension, and antihypertensive response to hydrochlorothiazide.
19635985 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19617352 the SGK1/Nedd4-2 signaling pathway regulates both CFTR and ENaC trafficking in CF epithelial cells
19615332 the loss of NEDD4 association on IL-2Rgamma(c) is accompanied by a dramatic increase of the half-life of the receptor subunit.
19381069 The protein-protein interaction between the WW domain of Fe65 and the putative binding motif of Nedd4-2 down-regulates Fe65 protein stability and subcellular localization through its ubiquitylation, to contribute to cell apoptosis.
19364400 Whereas the C2 domain-containing NEDD4L isoform is capable of shuttling between the plasma membrane and intracellular compartments in response to calcium stimulus the C2-lacking isoform can not.
19144635 the interplay between Nedd4-2-related E3 ligases that regulate ACK1 levels and Cbl that modifies EGF receptor impinges on cell receptor dynamics.
19143627 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
18591455 Physiological interaction between the ADD1 and WNK1-NEDD4L pathways influences the effects of variants in these genes on sodium-related BP regulation.
18591455 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18577513 Nedd4-2 differentially interacts with and regulates TTYH1-3
18498246 WW domains of Nedd4-2 bind (weakly) to a PY motif (LPXY) located within its own HECT domain and inhibit auto-ubiquitination. HECT PY-motif mutation does not affect ubiquitination or down-regulation of a known Nedd4-2 substrate, ENaC.
18322022 Nedd4-2 reduces the half-life of epithelial sodium channel subunits and enhances the ubiquitination of alpha, beta, and gamma epithelial sodium channels
18321969 budding of various HIV-1 L-domain mutants is dramatically enhanced by ectopic Nedd4-2s, a native isoform with a truncated C2 domain.
18321969 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
18321968 These observations suggest that NEDD4L and possibly other NEDD4-like proteins can ubiquitylate and activate ESCRT-I to function in virus budding.
18321968 Angiomotin (AMOT) stimulates NEDD4L-dependent release of HIV-1 Gag delta PTAP/YP in a does-dependent manner in 293T cells
18293164 Our results support rs3865418 but not rs4149601 polymorphism of NEDD4L gene implicated in the prevalence of hypertension in Chinese Hans.
18293164 Observational study of gene-disease association. (HuGE Navigator)
18268134 The human Nedd4L gene, especially the evolutionarily new isoform I, is a candidate gene for hypertension.
17652939 Observational study of genotype prevalence. (HuGE Navigator)
17544362 G-protein-coupled receptor kinase 2 interacts not only with epithelial Na(+) channels, but also with both Nedd4 and Nedd4-2
17502380 Nedd4-2 binds to and ubiquitinates ENaC at the cell surface, which targets surface ENaC for degradation, and thus, reduces epithelial Na(+) transport.
17487281 Genetic NEDD4L variation seems to affect salt sensitivity and P-renin in normotensive subjects, suggesting that genotyping of NEDD4L may be clinically useful to identify subjects who benefit from dietary salt restriction in the prevention of hypertension
17487281 Observational study of gene-disease association. (HuGE Navigator)
17331106 Study identified three NEDD4-2 missense changes in highly conserved residues (S233L, E271A and H515P) in families with photosensitive generalized epilepsy.
16788695 genetic NEDD4L variation affecting cross-sectional and longitudinal blood pressure is possibly as a consequence of altered NEDD4L interaction with ENaC
16716084 14-3-3 inhibits the interaction between the WW domains of hNedd4-2 and the PY motif of the epithelial Na(+) channel, ENaC
16103266 Observational study of gene-disease association. (HuGE Navigator)
16103266 Significant association between several SNPs and hypertension in US whites, Greek whites, and African-Americans. Genetic variation in NEDD4L may play role in development or progression of some forms of hypertension.
15576372 Nedd4-2 phosphorylation induces SGK ubiquitination and degradation
15328345 cAMP regulates ENaC in part by phosphorylation and inhibition of Nedd4-2. Moreover, Nedd4-2 is a central convergence point for kinase regulation of Na(+) transport.
15140763 The differential phosphorylation status between wild-type and mutant Nedd4-2 provides an explanation for the different potential to inhibit ENaC activity.
15044175 SGK1 stimulates the NaPi IIb, at least in part, by phosphorylating and thereby inhibiting Nedd4-2 binding to its target.
14615060 Results describe the isolation of three new NEDD4L transcripts designated NEDD4Lf, NEDD4Lg and NEDD4Lh, which encode different forms of the NEDD4L protein.
12876068 Alternate transcripts of Nedd4-2 may interact with ENaC differently. hNedd4-2 has role in regulation of ENaC. Protein domains are important for Nedd4-2 function.
12876068 Identification of multiple splice forms and 5' variants of Nedd4l. 5' variants inhibit ENaC-mediated Na+ transport when reconstituted in FRT epithelia. Other splice forms encode Nedd4L isoforms with 2 to 4 WW domains having varying affinity for ENaC.
12522688 The ubiquitin ligase NEDD4L is a candidate gene for essential hypertension on both functional and genetic grounds
12139396 This ubiquitin-protein ligase is expressed in mouse mandibular salivary duct cells and regulates the amiloride-sensitive Na+ conductance in these cells.
11840194 Candidate gene for autosomal dominant orthostatic hypotensive disorder.

AA Sequence

MATGLGEPVYGLSEDEGESRILRVKVVSGIDLAKKDIFGASDPYVKLSLYVADENRELALVQTKTIKKTL      1 - 70
NPKWNEEFYFRVNPSNHRLLFEVFDENRLTRDDFLGQVDVPLSHLPTEDPTMERPYTFKDFLLRPRSHKS     71 - 140
RVKGFLRLKMAYMPKNGGQDEENSDQRDDMEHGWEVVDSNDSASQHQEELPPPPLPPGWEEKVDNLGRTY    141 - 210
YVNHNNRTTQWHRPSLMDVSSESDNNIRQINQEAAHRRFRSRRHISEDLEPEPSEGGDVPEPWETISEEV    211 - 280
NIAGDSLGLALPPPPASPGSRTSPQELSEELSRRLQITPDSNGEQFSSLIQREPSSRLRSCSVTDAVAEQ    281 - 350
GHLPPPSAPAGRARSSTVTGGEEPTPSVAYVHTTPGLPSGWEERKDAKGRTYYVNHNNRTTTWTRPIMQL    351 - 420
AEDGASGSATNSNNHLIEPQIRRPRSLSSPTVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKP    421 - 490
QHKVTQSFLPPGWEMRIAPNGRPFFIDHNTKTTTWEDPRLKFPVHMRSKTSLNPNDLGPLPPGWEERIHL    491 - 560
DGRTFYIDHNSKITQWEDPRLQNPAITGPAVPYSREFKQKYDYFRKKLKKPADIPNRFEMKLHRNNIFEE    561 - 630
SYRRIMSVKRPDVLKARLWIEFESEKGLDYGGVAREWFFLLSKEMFNPYYGLFEYSATDNYTLQINPNSG    631 - 700
LCNEDHLSYFTFIGRVAGLAVFHGKLLDGFFIRPFYKMMLGKQITLNDMESVDSEYYNSLKWILENDPTE    701 - 770
LDLMFCIDEENFGQTYQVDLKPNGSEIMVTNENKREYIDLVIQWRFVNRVQKQMNAFLEGFTELLPIDLI    771 - 840
KIFDENELELLMCGLGDVDVNDWRQHSIYKNGYCPNHPVIQWFWKAVLLMDAEKRIRLLQFVTGTSRVPM    841 - 910
NGFAELYGSNGPQLFTIEQWGSPEKLPRAHTCFNRLDLPPYETFEDLREKLLMAVENAQGFEGVD         911 - 975
//

Text Mined References (153)

PMID Year Title
26740304 2016 Serum- and glucocorticoid-inducible kinase SGK2 regulates human organic anion transporters 4 via ubiquitin ligase Nedd4-2.
26608079 2016 Regulation of amino acid transporter trafficking by mTORC1 in primary human trophoblast cells is mediated by the ubiquitin ligase Nedd4-2.
26363003 2015 Regulation of the human ether-a-go-go-related gene (hERG) potassium channel by Nedd4 family interacting proteins (Ndfips).
26130719 2015 DDB2 modulates TGF-? signal transduction in human ovarian cancer cells by downregulating NEDD4L.
25785312 2015 Proteomics analysis of EV71-infected cells reveals the involvement of host protein NEDD4L in EV71 replication.
25631046 2015 Nedd4 family interacting protein 1 (Ndfip1) is required for ubiquitination and nuclear trafficking of BRCA1-associated ATM activator 1 (BRAT1) during the DNA damage response.
25542253 2015 Investigation of the possible association of NEDD4-2 (NEDD4L) gene with idiopathic photosensitive epilepsy.
25416956 2014 A proteome-scale map of the human interactome network.
25295397 2014 Structural basis of the activation and degradation mechanisms of the E3 ubiquitin ligase Nedd4L.
24831004 2014 Unique regulation of human Na+/H+ exchanger 3 (NHE3) by Nedd4-2 ligase that differs from non-primate NHE3s.
24657276 2014 The phosphorylation of endogenous Nedd4-2 In Na(+)-absorbing human airway epithelial cells.
24529757 2014 Genome-wide association study combining pathway analysis for typical sporadic amyotrophic lateral sclerosis in Chinese Han populations.
24456330 2014 Pathobiological properties of the ubiquitin ligase Nedd4L in melanoma.
24451387 2014 Nedd4-2 regulates surface expression and may affect N-glycosylation of hyperpolarization-activated cyclic nucleotide-gated (HCN)-1 channels.
24446284 2014 Gender flip-flop association between genetic variations of NEDD4L and metabolic syndrome in the Kazakh general population.
24373531 2014 Genetic risk variants for dyslexia on chromosome 18 in a German cohort.
24312311 2013 NEDD4L is downregulated in colorectal cancer and inhibits canonical WNT signaling.
24284497 2014 Genetic variation in NEDD4L, an epithelial sodium channel regulator, is associated with cardiovascular disease and cardiovascular death.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24214981 2013 A phosphoinositide 3-kinase (PI3K)-serum- and glucocorticoid-inducible kinase 1 (SGK1) pathway promotes Kv7.1 channel surface expression by inhibiting Nedd4-2 protein.
24047422 2014 Gender difference in association of NEDD4L gene variants among southern Han Chinese with essential hypertension - a population-based case-control study.
23999003 2013 SYT14L, especially its C2 domain, is involved in regulating melanocyte differentiation.
23812770 2013 Identification of the NEDD4L gene as a prognostic marker by integrated microarray analysis of copy number and gene expression profiling in non-small cell lung cancer.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23792956 2013 Regulation of the human ether-a-go-go-related gene (hERG) channel by Rab4 protein through neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2).
23686771 2013 Mutations in TNK2 in severe autosomal recessive infantile onset epilepsy.
23594824 2013 WNK4 inhibition of ENaC is independent of Nedd4-2-mediated ENaC ubiquitination.
23589291 2013 The serum- and glucocorticoid-inducible kinases SGK1 and SGK3 regulate hERG channel expression via ubiquitin ligase Nedd4-2 and GTPase Rab11.
23549273 2013 A functional variant of NEDD4L is associated with obesity and related phenotypes in a Han population of Southern China.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23529131 2013 Oestrogen promotes KCNQ1 potassium channel endocytosis and postendocytic trafficking in colonic epithelium.
23396981 2013 HECT domain-containing E3 ubiquitin ligase NEDD4L negatively regulates Wnt signaling by targeting dishevelled for proteasomal degradation.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23353631 2013 Association of variants in NEDD4L with blood pressure response and adverse cardiovascular outcomes in hypertensive patients treated with thiazide diuretics.
23262292 2013 Nedd4 and Nedd4-2: ubiquitin ligases at work in the neuron.
23236378 2012 Mammalian ? arrestins link activated seven transmembrane receptors to Nedd4 family e3 ubiquitin ligases and interact with ? arrestins.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22957059 2012 Genome-wide association study identified CNP12587 region underlying height variation in Chinese females.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
22904170 2012 Nedd4-2 does not regulate wt-CFTR in human airway epithelial cells.
22879586 2012 Cell surface expression of human ether-a-go-go-related gene (hERG) channels is regulated by caveolin-3 protein via the ubiquitin ligase Nedd4-2.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22754043 2012 A genome-wide association study of caffeine-related sleep disturbance: confirmation of a role for a common variant in the adenosine receptor.
22505712 2012 Protein kinase C (PKC)-promoted endocytosis of glutamate transporter GLT-1 requires ubiquitin ligase Nedd4-2-dependent ubiquitination but not phosphorylation.
22385262 2012 The Nedd4-like ubiquitin E3 ligases target angiomotin/p130 to ubiquitin-dependent degradation.
22361880 2012 The high-affinity choline transporter CHT1 is regulated by the ubiquitin ligase Nedd4-2.
22217575 2012 Down-regulation of Nedd4L is associated with the aggressive progression and worse prognosis of malignant glioma.
22024150 2012 Deubiquitylating enzyme USP2 counteracts Nedd4-2-mediated downregulation of KCNQ1 potassium channels.
22001757 2011 Genome-wide association study identifies loci influencing concentrations of liver enzymes in plasma.
21909941 2012 Decreased expression of Nedd4L correlates with poor prognosis in gastric cancer patient.
21900244 2011 Neural precursor cell-expressed developmentally down-regulated protein 4-2 (Nedd4-2) regulation by 14-3-3 protein binding at canonical serum and glucocorticoid kinase 1 (SGK1) phosphorylation sites.
21852580 2011 Nedd4-2 modulates renal Na+-Cl- cotransporter via the aldosterone-SGK1-Nedd4-2 pathway.
21478478 2011 Ubiquitin-specific protease 2-45 (Usp2-45) binds to epithelial Na+ channel (ENaC)-ubiquitylating enzyme Nedd4-2.
21463633 2011 Nedd4-2-dependent ubiquitylation and regulation of the cardiac potassium channel hERG1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21176637 2010 [Association between rs4149601 polymorphism and essential hypertension in Kazakh].
21154329 2010 [Association of the rs4149601 polymorphism of NEDD4L gene with obesity in Xinjiang Kazakh population].
21088674 2011 Association between NEDD4L gene and sodium lithium countertransport.
21057195 Regulation of voltage-gated ion channels in excitable cells by the ubiquitin ligases Nedd4 and Nedd4-2.
21052022 2011 A functional variant of the NEDD4L gene is associated with beneficial treatment response with ?-blockers and diuretics in hypertensive patients.
21039987 2011 Nedd4L modulates the transcription of metalloproteinase-1 and -13 genes to increase the invasive activity of gallbladder cancer.
20730100 2010 Interaction of serum- and glucocorticoid regulated kinase 1 (SGK1) with the WW-domains of Nedd4-2 is required for epithelial sodium channel regulation.
20675381 2010 Hrs controls sorting of the epithelial Na+ channel between endosomal degradation and recycling pathways.
20525693 2010 Serum and glucocorticoid-induced kinase (SGK) 1 and the epithelial sodium channel are regulated by multiple with no lysine (WNK) family members.
20504882 2010 Nedd4-2 interacts with occludin to inhibit tight junction formation and enhance paracellular conductance in collecting duct epithelia.
20466724 2010 Phosphopeptide screen uncovers novel phosphorylation sites of Nedd4-2 that potentiate its inhibition of the epithelial Na+ channel.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20090362 2010 Genetic variations in the sodium balance-regulating genes ENaC, NEDD4L, NDFIP2 and USP2 influence blood pressure and hypertension.
20086093 2010 HECT E3 ubiquitin ligase Nedd4-1 ubiquitinates ACK and regulates epidermal growth factor (EGF)-induced degradation of EGF receptor and ACK.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20064473 2009 Insights into ubiquitin transfer cascades from a structure of a UbcH5B approximately ubiquitin-HECT(NEDD4L) complex.
20051513 2010 Lysine 63-linked polyubiquitination of the dopamine transporter requires WW3 and WW4 domains of Nedd4-2 and UBE2D ubiquitin-conjugating enzymes.
20003179 2009 Genetic variation of NEDD4L is associated with essential hypertension in female Kazakh general population: a case-control study.
19953087 2009 Comparison of substrate specificity of the ubiquitin ligases Nedd4 and Nedd4-2 using proteome arrays.
19917253 2009 Ubiquitin ligase Nedd4L targets activated Smad2/3 to limit TGF-beta signaling.
19706893 2009 Divalent metal transporter 1 (DMT1) regulation by Ndfip1 prevents metal toxicity in human neurons.
19690890 2009 Genetic analysis of diabetic nephropathy on chromosome 18 in African Americans: linkage analysis and dense SNP mapping.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19664597 2009 Identification of NPC2 protein as interaction molecule with C2 domain of human Nedd4L.
19635985 2009 A functional variant of NEDD4L is associated with hypertension, antihypertensive response, and orthostatic hypotension.
19617352 2009 Rescue of DeltaF508-CFTR by the SGK1/Nedd4-2 signaling pathway.
19615332 2009 NEDD4-2 associates with gamma(c) and regulates its degradation rate.
19602703 2009 Down-regulating destruction: phosphorylation regulates the E3 ubiquitin ligase Nedd4-2.
19557014 2010 Nedd4 and Nedd4-2: closely related ubiquitin-protein ligases with distinct physiological functions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19381069 2009 Ubiquitylation of Fe65 adaptor protein by neuronal precursor cell expressed developmentally down regulated 4-2 (Nedd4-2) via the WW domain interaction with Fe65.
19364400 2009 A human polymorphism affects NEDD4L subcellular targeting by leading to two isoforms that contain or lack a C2 domain.
19343052 2009 Control of the activity of WW-HECT domain E3 ubiquitin ligases by NDFIP proteins.
19144635 2009 Down-regulation of active ACK1 is mediated by association with the E3 ubiquitin ligase Nedd4-2.
19028597 2009 Maturation of human dendritic cells is accompanied by functional remodelling of the ubiquitin-proteasome system.
18819914 2008 Nedd4 family-interacting protein 1 (Ndfip1) is required for the exosomal secretion of Nedd4 family proteins.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18591455 2008 Physiological interaction between alpha-adducin and WNK1-NEDD4L pathways on sodium-related blood pressure regulation.
18577513 2008 The ubiquitin-protein ligase Nedd4-2 differentially interacts with and regulates members of the Tweety family of chloride ion channels.
18498246 2008 Regulation of Nedd4-2 self-ubiquitination and stability by a PY motif located within its HECT-domain.
18322022 2008 Nedd4-2 isoforms ubiquitinate individual epithelial sodium channel subunits and reduce surface expression and function of the epithelial sodium channel.
18321969 2008 Efficient and specific rescue of human immunodeficiency virus type 1 budding defects by a Nedd4-like ubiquitin ligase.
18321968 2008 NEDD4L overexpression rescues the release and infectivity of human immunodeficiency virus type 1 constructs lacking PTAP and YPXL late domains.
18293164 2008 Two polymorphisms in NEDD4L gene and essential hypertension in Chinese Hans - a population-based case-control study.
18268134 2008 Expression, transcription, and possible antagonistic interaction of the human Nedd4L gene variant: implications for essential hypertension.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17652939 2008 Haplotype diversity in four genes (CLCNKA, CLCNKB, BSND, NEDD4L) involved in renal salt reabsorption.
17544362 2007 GRK2 interacts with and phosphorylates Nedd4 and Nedd4-2.
17502380 2007 Nedd4-2 catalyzes ubiquitination and degradation of cell surface ENaC.
17487281 2007 Polymorphism in NEDD4L is associated with increased salt sensitivity, reduced levels of P-renin and increased levels of Nt-proANP.
17331106 2007 NEDD4-2 as a potential candidate susceptibility gene for epileptic photosensitivity.
17289006 2007 The KCNQ1 potassium channel is down-regulated by ubiquitylating enzymes of the Nedd4/Nedd4-like family.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
16788695 2006 24-h ambulatory blood pressure is linked to chromosome 18q21-22 and genetic variation of NEDD4L associates with cross-sectional and longitudinal blood pressure in Swedes.
16716084 2006 14-3-3 Mediates phosphorylation-dependent inhibition of the interaction between the ubiquitin E3 ligase Nedd4-2 and epithelial Na+ channels.
16701206 2006 Cell survival through Trk neurotrophin receptors is differentially regulated by ubiquitination.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16177791 2005 DNA sequence and analysis of human chromosome 18.
16103266 2005 Association of NEDD4L ubiquitin ligase with essential hypertension.
15814530 2005 Nedd4-2 isoforms differentially associate with ENaC and regulate its activity.
15677482 2005 14-3-3 proteins modulate the expression of epithelial Na+ channels by phosphorylation-dependent interaction with Nedd4-2 ubiquitin ligase.
15576372 2005 Nedd4-2 phosphorylation induces serum and glucocorticoid-regulated kinase (SGK) ubiquitination and degradation.
15548568 2005 Molecular determinants of voltage-gated sodium channel regulation by the Nedd4/Nedd4-like proteins.
15496141 2005 NEDD4-2 (neural precursor cell expressed, developmentally down-regulated 4-2) negatively regulates TGF-beta (transforming growth factor-beta) signalling by inducing ubiquitin-mediated degradation of Smad2 and TGF-beta type I receptor.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15489223 2004 Nedd4-2 functionally interacts with ClC-5: involvement in constitutive albumin endocytosis in proximal tubule cells.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15328345 2004 cAMP and serum and glucocorticoid-inducible kinase (SGK) regulate the epithelial Na(+) channel through convergent phosphorylation of Nedd4-2.
15252135 2004 N4WBP5A (Ndfip2), a Nedd4-interacting protein, localizes to multivesicular bodies and the Golgi, and has a potential role in protein trafficking.
15231748 2004 Functional proteomics mapping of a human signaling pathway.
15217910 2004 Cardiac voltage-gated sodium channel Nav1.5 is regulated by Nedd4-2 mediated ubiquitination.
15140763 2004 A naturally occurring human Nedd4-2 variant displays impaired ENaC regulation in Xenopus laevis oocytes.
15044175 2004 Regulation of intestinal phosphate cotransporter NaPi IIb by ubiquitin ligase Nedd4-2 and by serum- and glucocorticoid-dependent kinase 1.
15040001 2004 Regulation of the voltage gated K+ channel Kv1.3 by the ubiquitin ligase Nedd4-2 and the serum and glucocorticoid inducible kinase SGK1.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14615060 2003 Androgens differentially regulate the expression of NEDD4L transcripts in LNCaP human prostate cancer cells.
14556380 2003 Identification of new partners of the epithelial sodium channel alpha subunit.
12911626 2003 Regulation of the glutamate transporter EAAT1 by the ubiquitin ligase Nedd4-2 and the serum and glucocorticoid-inducible kinase isoforms SGK1/3 and protein kinase B.
12876068 2003 Alternate promoters and variable splicing lead to hNedd4-2 isoforms with a C2 domain and varying number of WW domains.
12729930 2003 Characterization of the interactions between Nedd4-2, ENaC, and sgk-1 using surface plasmon resonance.
12522688 2002 Common variant of human NEDD4L activates a cryptic splice site to form a frameshifted transcript.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12139396 2002 Patch-clamp studies on epithelial sodium channels in salivary duct cells.
12050153 2002 Regulation of the epithelial sodium channel by N4WBP5A, a novel Nedd4/Nedd4-2-interacting protein.
11840194 2001 NEDD4L on human chromosome 18q21 has multiple forms of transcripts and is a homologue of the mouse Nedd4-2 gene.
11748237 2002 N4WBP5, a potential target for ubiquitination by the Nedd4 family of proteins, is a novel Golgi-associated protein.
11742982 2001 Phosphorylation of Nedd4-2 by Sgk1 regulates epithelial Na(+) channel cell surface expression.
11696533 2002 Serum and glucocorticoid-regulated kinase modulates Nedd4-2-mediated inhibition of the epithelial Na+ channel.
11562473 2001 Proteins related to the Nedd4 family of ubiquitin protein ligases interact with the L domain of Rous sarcoma virus and are required for gag budding from cells.
11244092 2001 The Nedd4-like protein KIAA0439 is a potential regulator of the epithelial sodium channel.
11046148 2000 Latent membrane protein 2A of Epstein-Barr virus binds WW domain E3 protein-ubiquitin ligases that ubiquitinate B-cell tyrosine kinases.
10594025 2000 Rsp5, a ubiquitin-protein ligase, is involved in degradation of the single-stranded-DNA binding protein rfa1 in Saccharomyces cerevisiae.
9455477 1997 Prediction of the coding sequences of unidentified human genes. VIII. 78 new cDNA clones from brain which code for large proteins in vitro.
9110174 1997 Large-scale concatenation cDNA sequencing.
8619474 1996 A "double adaptor" method for improved shotgun library construction.
8576257 1996 Cloning of human ubiquitin-conjugating enzymes UbcH6 and UbcH7 (E2-F1) and characterization of their interaction with E6-AP and RSP5.