Property Summary

NCBI Gene PubMed Count 26
PubMed Score 27.41
PubTator Score 19.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
ependymoma 2.300 2.1e-14
astrocytoma 1.300 4.4e-25
glioblastoma 2.500 4.3e-05
oligodendroglioma 1.100 5.6e-14
osteosarcoma 1.542 3.9e-03
medulloblastoma 2.000 7.7e-07
atypical teratoid / rhabdoid tumor 2.700 2.3e-09
medulloblastoma, large-cell 2.200 4.8e-05
primitive neuroectodermal tumor 2.100 5.3e-07
tuberculosis and treatment for 6 months 1.200 1.7e-04
Breast cancer 4.800 2.2e-02
pediatric high grade glioma 2.300 6.1e-07
pilocytic astrocytoma 1.400 2.3e-06
nasopharyngeal carcinoma 1.700 2.8e-03

Gene RIF (10)

PMID Text
23273898 One important function of Aurora A in mitotic cells is to promote microtubule nucleation around the chromatin by phosphorylating NEDD1, and thereby to promote functional spindle assembly.
23106787 The mice treated with small interfering (si) RNA targeting NEDD1 by the atelocollagen-mediated delivery system showed a significantly prolonged survival in a xenograft model of human gastric cancer.
22818914 Nek9 phosphorylates NEDD1 on Ser377 driving its recruitment and thereby that of gamma-tubulin to the centrosome in mitotic cells.
22595525 Data suggest that the NEDD1/gamma-tubulin interaction is finely tuned by multiple phosphorylation events in the S557-S574 region and is critical for spindle assembly.
20224777 a direct interaction with NEDD1 regulates gamma-tubulin recruitment to the centrosome
19509060 Data suggest that sequential phosphorylation of Nedd1 by Cdk1 and Plk1 plays a role in targeting gamma tubulin ring complex to the centrosome by promoting the interaction of Nedd1 with the gammaTuRC component gamma-tubulin, during mitosis.
19243593 Data propose NEDD1 may be a promising target for controlling cell proliferation, in particular if targeted in combination with Plk1 inhibitors.
19029337 FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
16461362 The NEED1 protein was characterized and its function in centriole duplication and spindle assembly determined.
16378099 GCP-WD (NEDD1) broadly mediates targeting of the gamma-tubulin ring complex to sites of microtubule nucleation and to the mitotic spindle, which is essential for spindle formation.

AA Sequence

MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVP      1 - 70
LLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLS     71 - 140
GEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPAS    141 - 210
GICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRML    211 - 280
KSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAASGGVQNSGIVREAPATSIA    281 - 350
TVLPQPMTSAMGKGTVAVQEKAGLPRSINTDTLSKETDSGKNQDFSSFDDTGKSSLGDMFSPIRDDAVVN    351 - 420
KGSDESIGKGDGFDFLPQLNSVFPPRKNPVTSSTSVLHSSPLNVFMGSPGKEENENRDLTAESKKIYMGK    421 - 490
QESKDSFKQLAKLVTSGAESGNLNTSPSSNQTRNSEKFEKPENEIEAQLICEPPINGSSTPNPKIASSVT    491 - 560
AGVASSLSEKIADSIGNNRQNAPLTSIQIRFIQNMIQETLDDFREACHRDIVNLQVEMIKQFHMQLNEMH    561 - 630
SLLERYSVNEGLVAEIERLREENKRLRAHF                                            631 - 660
//

Text Mined References (33)

PMID Year Title
24189344 2014 Common genetic variants on 1p13.2 associate with risk of autism.
23273898 2013 The role of NEDD1 phosphorylation by Aurora A in chromosomal microtubule nucleation and spindle function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23106787 2013 Intraperitoneal delivery of a small interfering RNA targeting NEDD1 prolongs the survival of scirrhous gastric cancer model mice.
22818914 2012 Nek9 phosphorylation of NEDD1/GCP-WD contributes to Plk1 control of ?-tubulin recruitment to the mitotic centrosome.
22747683 2012 Genetic variants associated with breast size also influence breast cancer risk.
22595525 2012 Novel NEDD1 phosphorylation sites regulate ?-tubulin binding and mitotic spindle assembly.
21399614 2011 Novel asymmetrically localizing components of human centrosomes identified by complementary proteomics methods.
20224777 2010 A direct interaction with NEDD1 regulates gamma-tubulin recruitment to the centrosome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19509060 2009 Sequential phosphorylation of Nedd1 by Cdk1 and Plk1 is required for targeting of the gammaTuRC to the centrosome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
19243593 2009 The centrosome protein NEDD1 as a potential pharmacological target to induce cell cycle arrest.
19029337 2008 FAM29A promotes microtubule amplification via recruitment of the NEDD1-gamma-tubulin complex to the mitotic spindle.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16541075 2006 The finished DNA sequence of human chromosome 12.
16462731 2006 The PITSLRE/CDK11p58 protein kinase promotes centrosome maturation and bipolar spindle formation.
16461362 2006 NEDD1-dependent recruitment of the gamma-tubulin ring complex to the centrosome is necessary for centriole duplication and spindle assembly.
16378099 2006 GCP-WD is a gamma-tubulin targeting factor required for centrosomal and chromatin-mediated microtubule nucleation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16051665 2005 Proteomic analysis of steady-state nuclear hormone receptor coactivator complexes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12852856 2003 Polo-like kinase 1 regulates Nlp, a centrosome protein involved in microtubule nucleation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12221128 2002 Centrosomal proteins CG-NAP and kendrin provide microtubule nucleation sites by anchoring gamma-tubulin ring complex.
11956313 2002 Direct binding of NuMA to tubulin is mediated by a novel sequence motif in the tail domain that bundles and stabilizes microtubules.
11076968 2000 The centrosomal protein C-Nap1 is required for cell cycle-regulated centrosome cohesion.
8838651 1996 Dynamic changes of NuMA during the cell cycle and possible appearance of a truncated form of NuMA during apoptosis.
7814034 1995 Assignment of the developmentally regulated gene NEDD1 to human chromosome 12q22 by fluorescence in situ hybridization.
7790358 1995 Cell cycle regulation of the activity and subcellular localization of Plk1, a human protein kinase implicated in mitotic spindle function.