Property Summary

NCBI Gene PubMed Count 37
PubMed Score 99.56
PubTator Score 75.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Gene RIF (26)

PMID Text
27328518 Nectin-4 expression, when compared with control group, was higher in endometriotic lesions of patients having ovarian endometriosis and peritoneal endometriosis. This difference was significant in the endometrium of patients having endometriosis.
26949052 Nectin-4 is critical for gallbladder cancer cell progression via PI3K/AKT pathway activation of Rac1.
26617807 The data presented in this study suggested that nectin-4 may be a therapeutic target for systemic lupus erythematous through affecting the cell apoptosis
25926640 In airway epithelial cells, measles virus spread requires the nectin-4/afadin complex and is based on cytoplasm transfer between columnar cells.
25888293 Nectin-4 is a significant prognostic predictor, and may play a critical role in pancreatic cancer. Nectin-4 may be novel therapeutic target for pancreatic cancer.
25529316 The present study described clinical investigation of the EDSS1 identified in a large consanguineous family; DNA sequence analysis revealed a novel homozygous nonsense mutation (181C>T, p.Asp61*) in the PVRL4 gene.
25275122 Authors show that the same key residues in the BC and FG loops of nectin-4 govern binding to the measles virus attachment protein hemagglutinin (H) and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25019423 Ovarian tissue expression and serum nectin 4 appear to be potential markers in ovarian cancer.
24577405 data outline a synergistic action of nectin-1 and -4 in the early steps of AJ formation and implicate this interaction in modulating the Rac1 signaling pathway
24335299 Ablation of nectin4 binding compromises CD46 usage by a hybrid vesicular stomatitis virus/measles virus.
23760251 Thus, while nectin-4 and CD46 interact functionally with the measles virus H protein beta4-beta5 hydrophobic groove, SLAM merely covers it.
23682311 Transformation of breast cancer cells is dependent on PVRL4.
23202587 structure of the membrane-distal domain of nectin-4 in complex with measles virus hemagglutinin (MV-H; structure shows nectin-4 binds the MV-H beta4-beta5 groove exclusively via its N-terminal IgV domain; the contact interface is dominated by hydrophobic interactions
23174504 We show that human nectin4 is fully functional as a canince distemper virus receptor.
22926846 Data suggest that expression of nectin-4 is up-regulated in eutopic endometrium of patients with endometriosis compared with control subjects.
22869128 crystals of nectin-4 diffracted to 1.8 A resolution and belonged to space group P2(1), with unit-cell parameters a = 33.1, b = 51.7, c = 56.9 A, beta = 94.7 degrees
22048310 measles virus targets nectin-4 to emerge in the airways
21901103 Measles virus infection reduced PVRL4 surface expression in MCF7 cells, a property that is characteristic of receptor-associated viral infections.
21526486 The findings of study suggest that increased expression of Nectin-4 may indicate a worse prognosis in breast cancer patients.
21346770 Sequence analysis revealed a homozygous missense mutation (c.635C>G; p.Pro212Arg) in the recently reported PVRL4 gene causing EDSS1
21333831 Ectoderma dysplasia-syndactyly syndrome. Second example of "nectinopathy".
20959669 nectin 4 may serve as a potential biomarker that helps discriminate benign gynecologic diseases from ovarian cancer in a panel with CA125.
20691405 Ectodermal dysplasia-syndactyly syndrome is the second known "nectinopathy" caused by mutations in a nectin adhesion molecule.
19679554 Nectin-4 might play a significant role in lung carcinogenesis, and it should be a new candidate serum and tissue biomarker, as well as a therapeutic target.
17474988 Nectin-4 was not detected in normal breast epithelium; by contrast Nectin-4 was expressed in ductal breast carcinoma.
15784625 the active form of TACE is overexpressed in breast tumors and may indicate that TACE is responsible for Nectin-4 shedding not only in vitro but also in vivo

AA Sequence

MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKLPCFYRGDSGEQVGQVAWARV      1 - 70
DAGEGAQELALLHSKYGLHVSPAYEGRVEQPPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQAR     71 - 140
LRLRVLVPPLPSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSRSAAVTSEFHL    141 - 210
VPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREGAMLKCLSEGQPPPSY    211 - 280
NWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASV    281 - 350
VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEESVGLRA    351 - 420
EGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENG    421 - 490
TLRAKPTGNGIYINGRGHLV                                                      491 - 510
//

Text Mined References (40)

PMID Year Title
27328518 2016 The role of the adhesion molecule Nectin-4 in the pathogenesis of endometriosis.
26949052 2016 A novel PI3K/AKT signaling axis mediates Nectin-4-induced gallbladder cancer cell proliferation, metastasis and tumor growth.
26617807 2015 Down-regulation of nectin-4 inhibits apoptosis in systemic lupus erythematous (SLE) through targeting Bcl-2/Bax pathway.
25926640 2015 The Nectin-4/Afadin Protein Complex and Intercellular Membrane Pores Contribute to Rapid Spread of Measles Virus in Primary Human Airway Epithelia.
25888293 2015 Nectin-4 expression contributes to tumor proliferation, angiogenesis and patient prognosis in human pancreatic cancer.
25529316 2015 A novel homozygous nonsense mutation in the PVRL4 gene and expansion of clinical spectrum of EDSS1.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25275122 2014 Different roles of the three loops forming the adhesive interface of nectin-4 in measles virus binding and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25019423 2014 The diagnostic efficacy of nectin 4 expression in ovarian cancer patients.
24577405 2014 Nectin-4 mutations causing ectodermal dysplasia with syndactyly perturb the rac1 pathway and the kinetics of adherens junction formation.
24335299 2014 Ablation of nectin4 binding compromises CD46 usage by a hybrid vesicular stomatitis virus/measles virus.
23760251 2013 The measles virus hemagglutinin ?-propeller head ?4-?5 hydrophobic groove governs functional interactions with nectin-4 and CD46 but not those with the signaling lymphocytic activation molecule.
23682311 2013 A role for PVRL4-driven cell-cell interactions in tumorigenesis.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23202587 2013 Structure of measles virus hemagglutinin bound to its epithelial receptor nectin-4.
23174504 2013 Canine distemper virus with the intact C protein has the potential to replicate in human epithelial cells by using human nectin4 as a receptor.
22926846 2012 Eutopic endometrium and peritoneal, ovarian and colorectal endometriotic tissues express a different profile of nectin-1, -3, -4 and nectin-like molecule 2.
22902367 2012 Nectin ectodomain structures reveal a canonical adhesive interface.
22869128 2012 Purification, crystallization and preliminary X-ray analysis of the IgV domain of human nectin-4.
22048310 2011 Adherens junction protein nectin-4 is the epithelial receptor for measles virus.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21901103 2011 Tumor cell marker PVRL4 (nectin 4) is an epithelial cell receptor for measles virus.
21526486 2011 The significance of Survivin and Nectin-4 expression in the prognosis of breast carcinoma.
21346770 2011 Mutation in PVRL4 gene encoding nectin-4 underlies ectodermal-dysplasia-syndactyly syndrome (EDSS1).
21333831 2011 [Mutations in gene PVRL4 encoding for cell adhesion molecule Nectin-4 in ectodermal dysplasia-syndactyly syndrome].
20959669 2010 Nectin 4 overexpression in ovarian cancer tissues and serum: potential role as a serum biomarker.
20691405 2010 Mutations in PVRL4, encoding cell adhesion molecule nectin-4, cause ectodermal dysplasia-syndactyly syndrome.
19679554 2009 Identification of nectin-4 oncoprotein as a diagnostic and therapeutic target for lung cancer.
17474988 2007 Nectin-4 is a new histological and serological tumor associated marker for breast cancer.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15784625 2005 Nectin-4, a new serological breast cancer marker, is a substrate for tumor necrosis factor-alpha-converting enzyme (TACE)/ADAM-17.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12011057 2002 Prominent role of the Ig-like V domain in trans-interactions of nectins. Nectin3 and nectin 4 bind to the predicted C-C'-C"-D beta-strands of the nectin1 V domain.
11544254 2001 Nectin4/PRR4, a new afadin-associated member of the nectin family that trans-interacts with nectin1/PRR1 through V domain interaction.
10225955 1999 Nectin/PRR: an immunoglobulin-like cell adhesion molecule recruited to cadherin-based adherens junctions through interaction with Afadin, a PDZ domain-containing protein.
9845526 1998 The human poliovirus receptor related 2 protein is a new hematopoietic/endothelial homophilic adhesion molecule.