Property Summary

NCBI Gene PubMed Count 31
PubMed Score 35.94
PubTator Score 22.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
esophageal adenocarcinoma 1.100 2.4e-02
glioblastoma multiforme -1.100 5.5e-09
atypical teratoid / rhabdoid tumor -2.500 2.3e-04
medulloblastoma -1.600 1.3e-02
medulloblastoma, large-cell -3.300 6.9e-03
adrenocortical carcinoma 1.471 2.2e-02
tuberculosis and treatment for 3 months -1.500 2.0e-06
lung cancer -1.900 2.3e-04
interstitial cystitis -1.200 4.8e-03
lung adenocarcinoma -1.200 7.1e-10
ductal carcinoma in situ -1.100 1.2e-02
invasive ductal carcinoma -1.400 8.3e-03
ulcerative colitis -1.200 4.0e-04
pituitary cancer 3.100 3.0e-08

Gene RIF (10)

PMID Text
26602083 Data suggest that 3 independent regions of TcdB (Clostridium difficile toxin B; 1372-1493, 1493-1848, 1851-2366) contribute to binding and entry of TcdB into mammalian cells; residues 1372-1493 are sufficient for interaction with PVRL3.
26038560 PVRL3 is a physiologically relevant binding partner that can serve as a target for the prevention of TcdB-induced cytotoxicity in C. difficile infection.
25690753 Expression of nectin-3 in pancreatic cancer can be a prognostic factor.
24386110 Nectin-3 is associated with the formation of cell junctions and be a putative suppressor molecule to the invasion of breast cancer cells.
24116228 Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation.
23898208 HIV-1 Tat downregulates the expression of poliovirus receptor-related 3 (PVRL3) in human primary T cells
22926846 Data suggest that expression of nectin-3 is up-regulated in eutopic endometrium of patients with endometriosis as compared with control subjects and up-regulated in all endometriotic lesions investigated compared with eutopic endometrium.
20634891 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MARTLRPSPLCPGGGKAQLSSASLLGAGLLLQPPTPPPLLLLLFPLLLFSRLCGALAGPIIVEPHVTAVW      1 - 70
GKNVSLKCLIEVNETITQISWEKIHGKSSQTVAVHHPQYGFSVQGEYQGRVLFKNYSLNDATITLHNIGF     71 - 140
SDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDSLIDGGNETVAAICIAATGKPVAHIDWEGDL    141 - 210
GEMESTTTSFPNETATIISQYKLFPTRFARGRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNW    211 - 280
FVGRKGVNLKCNADANPPPFKSVWSRLDGQWPDGLLASDNTLHFVHPLTFNYSGVYICKVTNSLGQRSDQ    281 - 350
KVIYISDPPTTTTLQPTIQWHPSTADIEDLATEPKKLPFPLSTLATIKDDTIATIIASVVGGALFIVLVS    351 - 420
VLAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNNLIRKDYLEEP    421 - 490
EKTQWNNVENLNRFERPMDYYEDLKMGMKFVSDEHYDENEDDLVSHVDGSVISRREWYV               491 - 549
//

Text Mined References (34)

PMID Year Title
26602083 2015 Binding and entry of Clostridium difficile toxin B is mediated by multiple domains.
26038560 2015 Identification of an epithelial cell receptor responsible for Clostridium difficile TcdB-induced cytotoxicity.
25690753 2015 Nectin expression in pancreatic adenocarcinoma: nectin-3 is associated with a poor prognosis.
25416956 2014 A proteome-scale map of the human interactome network.
24386110 2013 The expression of the Nectin complex in human breast cancer and the role of Nectin-3 in the control of tight junctions during metastasis.
24116228 2013 Nectin-3 (CD113) interacts with Nectin-2 (CD112) to promote lymphocyte transendothelial migration.
23758976 2013 Nectin-2 is a potential target for antibody therapy of breast and ovarian cancers.
22926846 2012 Eutopic endometrium and peritoneal, ovarian and colorectal endometriotic tissues express a different profile of nectin-1, -3, -4 and nectin-like molecule 2.
22902367 2012 Nectin ectodomain structures reveal a canonical adhesive interface.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21769484 2012 The cell adhesion gene PVRL3 is associated with congenital ocular defects.
20876797 2010 Silencing of thrombospondin-1 is critical for myc-induced metastatic phenotypes in medulloblastoma.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20633763 2010 Molecular analysis of germline t(3;6) and t(3;12) associated with conventional renal cell carcinomas indicates their rate-limiting role and supports the three-hit model of carcinogenesis.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19011627 2009 The surface protein TIGIT suppresses T cell activation by promoting the generation of mature immunoregulatory dendritic cells.
18084611 2007 Differential gene expression of primary cultured lymphatic and blood vascular endothelial cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16216929 2005 Inhibition of cell movement and proliferation by cell-cell contact-induced interaction of Necl-5 with nectin-3.
15811349 2005 PICK-1: a scaffold protein that interacts with Nectins and JAMs at cell junctions.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12759359 2003 Recruitment of nectin-3 to cell-cell junctions through trans-heterophilic interaction with CD155, a vitronectin and poliovirus receptor that localizes to alpha(v)beta3 integrin-containing membrane microdomains.
12515806 2003 Direct binding of cell polarity protein PAR-3 to cell-cell adhesion molecule nectin at neuroepithelial cells of developing mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438620 2002 Mutations in the N-terminal domains of nectin-1 and nectin-2 reveal differences in requirements for entry of various alphaherpesviruses and for nectin-nectin interactions.
12011057 2002 Prominent role of the Ig-like V domain in trans-interactions of nectins. Nectin3 and nectin 4 bind to the predicted C-C'-C"-D beta-strands of the nectin1 V domain.
11544254 2001 Nectin4/PRR4, a new afadin-associated member of the nectin family that trans-interacts with nectin1/PRR1 through V domain interaction.
11024295 2000 Human nectin3/PRR3: a novel member of the PVR/PRR/nectin family that interacts with afadin.
10744716 2000 Nectin-3, a new member of immunoglobulin-like cell adhesion molecules that shows homophilic and heterophilic cell-cell adhesion activities.
10225955 1999 Nectin/PRR: an immunoglobulin-like cell adhesion molecule recruited to cadherin-based adherens junctions through interaction with Afadin, a PDZ domain-containing protein.
9845526 1998 The human poliovirus receptor related 2 protein is a new hematopoietic/endothelial homophilic adhesion molecule.