Property Summary

NCBI Gene PubMed Count 75
PubMed Score 361.38
PubTator Score 178.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.370 4.3e-04
posterior fossa group A ependymoma -1.200 3.7e-12
non-small cell lung cancer 1.187 8.7e-15
lung cancer 2.700 8.0e-04

Protein-protein Interaction (1)

Gene RIF (50)

PMID Text
27044745 PDZD11 forms a complex with nectin-1 and nectin-3, and its PDZ domain interacts directly with the PDZ-binding motif of nectin-1.
25966106 mutations in exons 2 and 5 of PVRL1, and T334A, A391T, G1183A in the alpha-spliced transcript, and G1082T in the beta-spliced transcript do not participate in the development of non-syndromic cleft of the lip and/or palate in patients from Guangdong.
25414835 Host nectin-1 is required for efficient Chlamydia trachomatis serovar E development.
25395582 data suggests that E-cadherin regulates assembly of nectin junctions through alpha-catenin-induced remodeling of the actin cytoskeleton around the cadherin clusters.
25275122 Authors show that the same key residues in the BC and FG loops of nectin-4 govern binding to the measles virus attachment protein hemagglutinin (H) and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25231300 These data provided solid structural and functional evidence that herpes simplex virus 1 and herpes simplex virus 2 gD proteins recognize nectin-1 via the same binding mode.
24902525 The results showed that the interface between the BV gD and nectin-1 molecule is not geometrically complementary.
24586397 HIV-1 gp120-mediated disruption of polarized oral epithelial junctions leads to exposure of nectin-1 and facilitate its binding to HSV-1
24581844 We identified new supportive evidence that the association between PVRL1 gene and nsCL/P in Turkish patients.
24314649 The conformation of the N-terminus of herpes simplex virus gD is induced by direct binding to HVEM and nectin-1.
24163161 These results suggest that HVEM might play more important roles than CD28 in ConA-mediated T cell proliferation
24100313 Glycoprotein D (gD) epitope core structure maps to the external surface of herpesvirus (HSV) gD, corresponding to the binding sites of two receptors, herpesvirus entry mediator (HVEM) and nectin-1, which mediate HSV infection.
22955284 Nectin-1 Ig3 induced phosphorylation of FGFR1c in the same manner as the whole nectin-1 ectodomain, and promoted survival of cerebellar granule neurons induced to undergo apoptosis.
22460696 This study demonistated that increased expression of nectin-1 in MS lesions plays a role in the pathogenesis of MS through participation in axonal responses to injury and mediation of altered neuron-glia interactions relevant to myelination.
22455396 NSCL/P-associated mutations of PVRL1
22171266 alphaVbeta3-integrin relocalizes nectin1 to lipid rafts, independently of herpes simplex virus 1.
21980294 Structure of herpes simplex virus glycoprotein D bound to the human receptor nectin-1.
20672350 Observational study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20572854 Observational study of gene-disease association. (HuGE Navigator)
20543867 A nonpredicted link between SNAI1-triggered EMT and the down-regulation of Nectin-1 and StarD10 through the up-regulation of miR-661, which may contribute to the invasion of breast cancer cells and poor disease outcome.
20501653 alpha- and gamma-secretase processing of nectin-1 is a Ca(2+)/calmodulin-regulated event that occurs under conditions of activity-dependent synaptic plasticity and ADAM10 and gamma-secretase are responsible for these cleavage events.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19715471 results suggest that PVRL1 may play a minor role in susceptibility to the occurrence of nsCL/P in some Caucasian populations, and that variation involving the beta (HIgR) isoform might have particular importance for risk of orofacial clefts
19715471 Observational study of gene-disease association. (HuGE Navigator)
19457990 Insertional mutations of gB reduced cell fusion activity when PILRalpha was overexpressed much more than nectin-1.
19408722 There is no relationship between nonsyndromic cleft lip and/or palate and PVRL1exon3 in Han People.
19408722 Observational study of gene-disease association. (HuGE Navigator)
18983929 These results indicate that nectin-1 is degraded by chlamydial protease-like activity factor (CPAF) in Chlamydia trachomatis-infected genital epithelial cells, a novel strategy that Chlamydiae may use to aid their dissemination.
18978678 Observational study of gene-disease association. (HuGE Navigator)
18803666 Antibodies against nectin-1, but not HVEM, were able to block HSV-1 infection.Anti-nectin-1 antibodies and F-actin depolymerizers were also successful in blocking the cytoskeletal changes that occur upon HSV-1 entry into cells
18451037 Western blot analyses demonstrated that accumulation of host nectin-1 is decreased by 85 % at 48 hours post-infection (h.p.i.) in Chlamydia trachomatis serovar E-infected HeLa cells.
18356023 Novel non-synonymous PVRL1 mutation of the substitution of valine by methionine a position 395 in a conserved sequence suggests a possible etiologic role of PVRL1 in non-syndromic CL/P across different populations.
18356023 Observational study of gene-disease association. (HuGE Navigator)
18076965 These data suggest that the determinants of gD-mediated internalization of nectin-1 may direct HSV to an endocytic pathway during entry.
17164781 nectin-1 may be used as a marker to predict the sensitivity of a tumor to herpes oncolytic therapy
17089422 Observational study of gene-disease association. (HuGE Navigator)
17089422 the role of PVRL1 in the sporadic forms of orofacial clefting in multiple populations was studied.
17005657 Access to nectin-1 contributes to preferential apical infection of human epithelial cells by herpes simplex virus.
16674562 Observational study of gene-disease association. (HuGE Navigator)
16674562 Mutations within the PVRL1 gene represent risk factors for non-syndromic cleft lip with or without cleft palate.
16497481 mutations at codons 185 and 323, especially the W185X mutation, do not participate in the formation of cleft lip and palate within the Taiwanese population examined
16247549 Observational study of gene-disease association. (HuGE Navigator)
16122939 Observational study of gene-disease association. (HuGE Navigator)
15857834 trans-interacting nectin inhibits non-trans-interacting E-cadherin endocytosis through afadin, Rap1, and p120ctn and further accumulates non-trans-interacting E-cadherin to the nectin-based cell-cell adhesion sites for the formation of adherens junctions
15731277 Nectin-1-Delta2 exhibited a severely reduced ability to mediate HSV entry and accumulated in the endoplasmic reticulum but retained the ability to interact with its HSV ligand, gD.
15110526 both nectin 1 and HVEM receptors play a role during HSV infection in vivo and both are highly efficient even at low levels of expression
12915568 association of HVEM and nectin-1 with lipid rafts during herpes simplex virus entry
12438620 Regions of nectin-1 protein important for herpesvirus entry activity and homotypic nectin-nectin interactions are overlapping but not identical.
12072519 evidence that nectin-1 confined to adherens junctions in epithelial cells is not very accessible to virus, whereas dissociation of cell junctions releases nectin-1 to serve more efficiently as an entry receptor

AA Sequence

MARMGLAGAAGRWWGLALGLTAFFLPGVHSQVVQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKS      1 - 70
TNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNL     71 - 140
TVMAKPTNWIEGTQAVLRAKKGQDDKVLVATCTSANGKPPSVVSWETRLKGEAEYQEIRNPNGTVTVISR    141 - 210
YRLVPSREAHQQSLACIVNYHMDRFKESLTLNVQYEPEVTIEGFDGNWYLQRMDVKLTCKADANPPATEY    211 - 280
HWTTLNGSLPKGVEAQNRTLFFKGPINYSLAGTYICEATNPIGTRSGQVEVNITEFPYTPSPPEHGRRAG    281 - 350
PVPTAIIGGVAGSILLVLIVVGGIVVALRRRRHTFKGDYSTKKHVYGNGYSKAGIPQHHPPMAQNLQYPD    351 - 420
DSDDEKKAGPLGGSSYEEEEEEEEGGGGGERKVGGPHPKYDEDAKRPYFTVDEAEARQDGYGDRTLGYQY    421 - 490
DPEQLDLAENMVSQNDGSFISKKEWYV                                               491 - 517
//

Text Mined References (83)

PMID Year Title
27044745 2016 PLEKHA7 Recruits PDZD11 to Adherens Junctions to Stabilize Nectins.
26787460 2016 Proteomic peptide phage display uncovers novel interactions of the PDZ1-2 supramodule of syntenin.
25966106 2015 Mutation analysis of PVRL1 in patients with non-syndromic cleft of the lip and/or palate in Guangdong.
25414835 2014 Host nectin-1 is required for efficient Chlamydia trachomatis serovar E development.
25395582 2015 Cadherin controls nectin recruitment into adherens junctions by remodeling the actin cytoskeleton.
25275122 2014 Different roles of the three loops forming the adhesive interface of nectin-4 in measles virus binding and cell entry, nectin-4 homodimerization, and heterodimerization with nectin-1.
25231300 2014 Crystal structure of herpes simplex virus 2 gD bound to nectin-1 reveals a conserved mode of receptor recognition.
25158072 2015 Cross-disorder genome-wide analyses suggest a complex genetic relationship between Tourette's syndrome and OCD.
24902525 2014 Herpes B virus gD interaction with its human receptor--an in silico analysis approach.
24581844 2014 Novel insertion mutation in the PVRL1 gene in Turkish patients with non-syndromic cleft lip with/without cleft palate.
24314649 2014 Induction of conformational changes at the N-terminus of herpes simplex virus glycoprotein D upon binding to HVEM and nectin-1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24163161 2014 Concanavalin A-mediated T cell proliferation is regulated by herpes virus entry mediator costimulatory molecule.
24100313 2013 Structural basis for the antibody neutralization of herpes simplex virus.
22955284 2012 Nectin-1 binds and signals through the fibroblast growth factor receptor.
22902367 2012 Nectin ectodomain structures reveal a canonical adhesive interface.
22460696 2013 Increased axonal expression of nectin-1 in multiple sclerosis plaques.
22455396 2012 PVRL1 as a candidate gene for nonsyndromic cleft lip with or without cleft palate: no evidence for the involvement of common or rare variants in southern Han Chinese patients.
22171266 2012 ?V?3-integrin relocalizes nectin1 and routes herpes simplex virus to lipid rafts.
22146396 2011 Binding of herpes simplex virus glycoprotein D to nectin-1 exploits host cell adhesion.
21982860 2012 A secreted protein microarray platform for extracellular protein interaction discovery.
21980294 2011 Structure of herpes simplex virus glycoprotein D bound to the human receptor nectin-1.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20672350 2010 Genetic variants in COL2A1, COL11A2, and IRF6 contribute risk to nonsyndromic cleft palate.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
20572854 2010 MTHFR and MSX1 contribute to the risk of nonsyndromic cleft lip/palate.
20543867 2010 miR-661 expression in SNAI1-induced epithelial to mesenchymal transition contributes to breast cancer cell invasion by targeting Nectin-1 and StarD10 messengers.
20501653 2010 Activity-dependent alpha-cleavage of nectin-1 is mediated by a disintegrin and metalloprotease 10 (ADAM10).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19715471 2009 Mutation analysis of the PVRL1 gene in caucasians with nonsyndromic cleft lip/palate.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19457990 2009 Differential effects on cell fusion activity of mutations in herpes simplex virus 1 glycoprotein B (gB) dependent on whether a gD receptor or a gB receptor is overexpressed.
19408722 2009 [Relationship of nonsyndromic cleft lip and/or palate and poliovirus receptor-related 1 exon 3 polymorphisms in Han people of Jiangzhe area].
19349973 2009 Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
18983929 2009 The host adherens junction molecule nectin-1 is degraded by chlamydial protease-like activity factor (CPAF) in Chlamydia trachomatis-infected genital epithelial cells.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18803666 2008 Role for nectin-1 in herpes simplex virus 1 entry and spread in human retinal pigment epithelial cells.
18451037 2008 The host adherens junction molecule nectin-1 is downregulated in Chlamydia trachomatis-infected genital epithelial cells.
18358807 2008 PILRalpha is a herpes simplex virus-1 entry coreceptor that associates with glycoprotein B.
18356023 2008 Study of the poliovirus receptor related-1 gene in Thai patients with non-syndromic cleft lip with or without cleft palate.
18076965 2008 The herpes simplex virus receptor nectin-1 is down-regulated after trans-interaction with glycoprotein D.
17164781 2007 Nectin-1 expression by squamous cell carcinoma is a predictor of herpes oncolytic sensitivity.
17089422 2006 PVRL1 variants contribute to non-syndromic cleft lip and palate in multiple populations.
17005657 2006 Access to nectin favors herpes simplex virus infection at the apical surface of polarized human epithelial cells.
16679515 2006 Interaction of integrin alpha(v)beta3 with nectin. Implication in cross-talk between cell-matrix and cell-cell junctions.
16674562 2006 Study of the PVRL1 gene in Italian nonsyndromic cleft lip patients with or without cleft palate.
16497481 2006 A study of PVRL1 mutations for non-syndromic cleft lip and/or palate among Taiwanese patients.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16247549 2006 PAX9 and TGFB3 are linked to susceptibility to nonsyndromic cleft lip with or without cleft palate in the Japanese: population-based and family-based candidate gene analyses.
16122939 2005 Mutation analysis of CLPTM 1 and PVRL 1 genes in patients with non-syndromic clefts of lip, alveolus and palate.
15857834 2005 Regulation of E-cadherin endocytosis by nectin through afadin, Rap1, and p120ctn.
15731277 2005 Deletion of the second immunoglobulin-like domain of nectin-1 alters its intracellular processing and localization and ability to mediate entry of herpes simplex virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146195 2004 Time-controlled transcardiac perfusion cross-linking for the study of protein interactions in complex tissues.
15110526 2004 Comparative usage of herpesvirus entry mediator A and nectin-1 by laboratory strains and clinical isolates of herpes simplex virus.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12915568 2003 Specific association of glycoprotein B with lipid rafts during herpes simplex virus entry.
12885915 2003 Cellular localization of nectin-1 and glycoprotein D during herpes simplex virus infection.
12764381 2003 Functional characterization of human CD34+ cells that express low or high levels of the membrane antigen CD111 (nectin 1).
12515806 2003 Direct binding of cell polarity protein PAR-3 to cell-cell adhesion molecule nectin at neuroepithelial cells of developing mouse.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12438620 2002 Mutations in the N-terminal domains of nectin-1 and nectin-2 reveal differences in requirements for entry of various alphaherpesviruses and for nectin-nectin interactions.
12011057 2002 Prominent role of the Ig-like V domain in trans-interactions of nectins. Nectin3 and nectin 4 bind to the predicted C-C'-C"-D beta-strands of the nectin1 V domain.
11756979 2002 Search for polymorphisms in the genes for herpesvirus entry mediator, nectin-1, and nectin-2 in immune seronegative individuals.
11559849 2001 Mutation of PVRL1 is associated with sporadic, non-syndromic cleft lip/palate in northern Venezuela.
11544254 2001 Nectin4/PRR4, a new afadin-associated member of the nectin family that trans-interacts with nectin1/PRR1 through V domain interaction.
11356977 2001 Novel, soluble isoform of the herpes simplex virus (HSV) receptor nectin1 (or PRR1-HIgR-HveC) modulates positively and negatively susceptibility to HSV infection.
11277703 2001 Porcine HveC, a member of the highly conserved HveC/nectin 1 family, is a functional alphaherpesvirus receptor.
10932188 2000 Mutations of PVRL1, encoding a cell-cell adhesion molecule/herpesvirus receptor, in cleft lip/palate-ectodermal dysplasia.
10617658 2000 Interaction of nectin with afadin is necessary for its clustering at cell-cell contact sites but not for its cis dimerization or trans interaction.
10225955 1999 Nectin/PRR: an immunoglobulin-like cell adhesion molecule recruited to cadherin-based adherens junctions through interaction with Afadin, a PDZ domain-containing protein.
9861033 1998 The V domain of herpesvirus Ig-like receptor (HIgR) contains a major functional region in herpes simplex virus-1 entry into cells and interacts physically with the viral glycoprotein D.
9845526 1998 The human poliovirus receptor related 2 protein is a new hematopoietic/endothelial homophilic adhesion molecule.
9811737 1998 The ectodomain of a novel member of the immunoglobulin subfamily related to the poliovirus receptor has the attributes of a bona fide receptor for herpes simplex virus types 1 and 2 in human cells.
9758630 1998 Linkage disequilibrium mapping of the gene for Margarita Island ectodermal dysplasia (ED4) to 11q23.
9696799 1998 Herpes simplex virus glycoprotein D can bind to poliovirus receptor-related protein 1 or herpesvirus entry mediator, two structurally unrelated mediators of virus entry.
9657005 1998 A cell surface protein with herpesvirus entry activity (HveB) confers susceptibility to infection by mutants of herpes simplex virus type 1, herpes simplex virus type 2, and pseudorabies virus.
9616127 1998 Entry of alphaherpesviruses mediated by poliovirus receptor-related protein 1 and poliovirus receptor.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
7721102 1995 Complementary DNA characterization and chromosomal localization of a human gene related to the poliovirus receptor-encoding gene.
1776626 1991 Autosomal recessive ectodermal dysplasia: I. An undescribed dysplasia/malformation syndrome.
1034214 1976 A human chromosomal determinant for susceptibility to herpes simplex virus.