Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.79
PubTator Score 7.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.900 6.9e-03
ependymoma -2.000 1.3e-02
glioblastoma -1.500 5.9e-06
atypical teratoid / rhabdoid tumor -2.100 9.6e-08
medulloblastoma, large-cell -1.500 3.0e-05
adult high grade glioma -1.300 9.3e-04
pilocytic astrocytoma -1.200 3.0e-06
sonic hedgehog group medulloblastoma -1.100 1.1e-03
subependymal giant cell astrocytoma -1.847 5.2e-03
lung carcinoma 1.200 3.5e-32
Pick disease -1.300 2.4e-02
acute myeloid leukemia 1.500 2.5e-03
ovarian cancer 1.700 2.9e-04

Gene RIF (2)

PMID Text
24399846 NECAP1 mutation links trafficking pathway in early infantile epileptic encephalopathy.
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKTAYIKLEDKVSGELFA      1 - 70
QAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFTDRGDAFDFNVSLQDHFKWVKQESEISKES     71 - 140
QEMDARPKLDLGFKEGQTIKLCIGNITNKKGGASKPRTARGGGLSLLPPPPGGKVTIPPPSSSVAISNHV    141 - 210
TPPPIPKSNHGGSDADILLDLDSPAPVTTPAPTPVSVSNDLWGDFSTASSSVPNQAPQPSNWVQF         211 - 275
//

Text Mined References (14)

PMID Year Title
24399846 2014 NECAP1 loss of function leads to a severe infantile epileptic encephalopathy.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21269460 2011 Initial characterization of the human central proteome.
20237496 2010 New genetic associations detected in a host response study to hepatitis B vaccine.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16879712 2006 Characterization of the localization and function of NECAP 1 in neurons.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15494011 2004 Molecular mechanisms in clathrin-mediated membrane budding revealed through subcellular proteomics.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15292237 2004 Dual engagement regulation of protein interactions with the AP-2 adaptor alpha appendage.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14555962 2003 Identification of a family of endocytic proteins that define a new alpha-adaptin ear-binding motif.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.