Property Summary

NCBI Gene PubMed Count 14
PubMed Score 5.89
PubTator Score 5.69

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma -1.300 1.1e-03
Astrocytoma, Pilocytic -1.400 1.2e-07
atypical teratoid/rhabdoid tumor -1.100 2.3e-05
glioblastoma -1.100 7.3e-06
group 3 medulloblastoma -1.100 1.6e-02
osteosarcoma 2.016 9.0e-09
psoriasis -1.400 1.7e-04

Gene RIF (6)

AA Sequence

MACAGLLTVCLLRPPAPQPQPQTPRHPQLAPDPGPAGHTLFQDVFRRADKNDDGKLSFEEFQNYFADGVL      1 - 70
SLGELQELFSGIDGHLTDNLETEKLCDYFSEHLGVYRPVLAALESLNRAVLAAMDATKLEYERASKVDQF     71 - 140
VTRFLLRETVSQLQALQSSLEGASDTLEAQAHGWRSDAESVEAQSRLCGSRRAGRRALRSVSRSSTWSPG    141 - 210
SSDTGRSSEAEMQWRLQVNRLQELIDQLECKVRAVGPGPHKGGPSWYPPEPGPCWRPGPHSVPSQAPRLE    211 - 280
PLREEDLAKGPDLHILMAQRQVQVAEEGLQDFHRALRCYVDFTGAQSHCLHVSAQKMLDGASFTLYEFWQ    281 - 350
DEASWRRHQQSPGSKAFQRILIDHLRAPDTLTTVFFPASWWIMNNN                            351 - 396
//

Text Mined References (14)

PMID Year Title