Property Summary

NCBI Gene PubMed Count 25
PubMed Score 15.33
PubTator Score 8.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 4.9e-04
breast carcinoma 1.200 6.8e-04
medulloblastoma, large-cell -1.100 5.0e-03

 IMPC Phenotype (1)

 GWAS Trait (1)

Gene RIF (11)

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATAGLHRQLLYITAFFFA      1 - 70
GYYLVKREDYLYAVRDREMFGYMKLHPEDFPEEDKKTYGEIFEKFHPIR                          71 - 119
//

Text Mined References (28)

PMID Year Title