Property Summary

NCBI Gene PubMed Count 13
PubMed Score 0.54
PubTator Score 0.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.124 6.2e-03
Multiple myeloma 1.542 1.1e-04
astrocytic glioma -1.100 7.0e-03
medulloblastoma, large-cell -1.100 1.4e-03
acute quadriplegic myopathy -1.275 8.0e-05
lung cancer 1.600 8.6e-03
active ulcerative colitis -1.034 9.5e-03
gastric carcinoma -1.500 1.4e-02
acute myeloid leukemia -1.100 1.0e-02
ovarian cancer -1.200 2.1e-04

AA Sequence

MAPSALLRPLSRLLAPARLPSGPSVRSKFYVREPPNAKPDWLKVGFTLGTTVFLWIYLIKQHNEDILEYK      1 - 70
RRNGLE                                                                     71 - 76
//

Text Mined References (13)

PMID Year Title
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
9878551 1998 cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.
9763677 1998 Intron based radiation hybrid mapping of 15 complex I genes of the human electron transport chain.
9653160 1998 Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.
9425316 1997 Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.