1. Home
  2. Targets
  3. oxidoreductase
  4. NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9

Tclin NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed to be not involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

The protein encoded by this gene is a subunit of the mitochondrial oxidative phosphorylation complex I (nicotinamide adenine dinucleotide: ubiquinone oxidoreductase). Complex I is localized to the inner mitochondrial membrane and functions to dehydrogenate nicotinamide adenine dinucleotide and to shuttle electrons to coenzyme Q. Complex I deficiency is the most common defect found in oxidative phosphorylation disorders and results in a range of conditions, including lethal neonatal disease, hypertrophic cardiomyopathy, liver disease, and adult-onset neurodegenerative disorders. Pseudogenes of this gene are found on chromosomes five, seven and eight. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]

 Comments

Property Summary

Ligand Count 1
NCBI Gene PubMed Count 25
PubMed Score 263.51
PubTator Score 84.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Mitochondrial complex I deficiency 46 0.0 5.0
Weight Gain 100 0.0 0.0
Disease Target Count
Abnormal mitochondria in muscle tissue 20
Acidosis, Lactic 97
Acute necrotizing encephalopathy 14
Atrophy of cerebellum 103
Autosomal recessive predisposition 1442
Babinski Reflex 100
Blepharoptosis 231
Blind Vision 111
Blindness, Legal 110
Brain Edema 50
CSF lactate increased 33
Cerebellar Ataxia 304
Cerebellar degeneration 103
Cerebral Edema 30
Cognitive delay 608
Comatose 56
Decreased tendon reflex 122
Developmental regression 95
Epilepsy 792
Failure to gain weight 365
Feeding difficulties in infancy 175
Global developmental delay 608
Growth delay 114
Growth failure 114
Growth retardation 115
Highly variable clinical phenotype 150
Highly variable phenotype and severity 150
Highly variable phenotype, even within families 150
Hyperreflexia 209
Hypertrophic Cardiomyopathy 117
Hypoglycemia 152
Impaired exercise tolerance 42
Infratentorial atrophy 103
Lactic acidemia 95
Lethargy 77
Leukodystrophy 55
Liver Failure 73
Loss of developmental milestones 95
Mental and motor retardation 608
Mental deterioration in childhood 95
Muscle Spasticity 195
Muscle Weakness 170
Muscle hypotonia 571
NADH:Q(1) Oxidoreductase deficiency 24
Neurodevelopmental regression 95
Neurogenic Muscular Atrophy 139
Neurogenic muscle atrophy, especially in the lower limbs 139
Nystagmus 317
Pallor of optic disc 39
Pediatric failure to thrive 365
Phenotypic variability 150
Poor growth 114
Progressive macrocephaly 18
Psychomotor regression 95
Psychomotor regression beginning in infancy 95
Psychomotor regression in infants 95
Psychomotor regression, progressive 95
Respiratory Failure 104
Seizures 596
Sensorineural Hearing Loss (disorder) 284
Skeletal muscle atrophy 139
Strabismus 270
Very poor growth 114
Vomiting 116
X-linked dominant 57
muscle degeneration 139
Disease Target Count P-value
Breast cancer 3578 3.2e-04
ovarian cancer 8520 6.6e-04
Disease Target Count Z-score Confidence
Osgood-Schlatter's disease 6 3.911 2.0
Toxoplasmosis 17 3.253 1.6
Disease Target Count
Mitochondrial Complex 1 Deficiency 28

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.100 3.2e-04
ovarian cancer 1.800 6.6e-04

Synonym

Accession Q9Y6M9 B2R8M6 Q9UQE8
Symbols B22
LYRM3
CI-B22
UQOR22

Gene

NDUFB9

PANTHER Protein Class (1)

  Ortholog (14)

Species Source Disease
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA EggNOG
Inparanoid OMA
Inparanoid OMA EggNOG
OMA EggNOG
Inparanoid OMA EggNOG
OMA EggNOG
Inparanoid OMA EggNOG

 UniProt Keyword (13)

See all...

 GO Function (1)

 GO Component (4)

 GO Process (3)

 Compartment GO Term (39)

See all...

 IMPC Phenotype (1)

 HCA RNA Cell Line (56)

See all...

Pathway (15)

See all...

PDB (4)

Drug (1)

Structure of metformin

metformin

Gene RIF (7)

AA Sequence 

MAFLASGPYLTHQQKVLRLYKRALRHLESWCVQRDKYRYFACLMRARFEEHKNEKDMAKATQLLKEAEEE      1 - 70
FWYRQHPQPYIFPDSPGGTSYERYDCYKVPEWCLDDWHPSEKAMYPDYFAKREQWKKLRRESWEREVKQL     71 - 140
QEETPPGGPLTEALPPARKEGDLPPLWWYIVTRPRERPM                                   141 - 179
//

Text Mined References (30)

PMID Year Title