Property Summary

NCBI Gene PubMed Count 20
PubMed Score 121.51
PubTator Score 62.71

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.124 6.8e-04
astrocytoma -1.500 8.6e-04
ependymoma -1.200 2.2e-02
glioblastoma -1.700 2.0e-04

Gene RIF (4)

PMID Text
19064571 Observational study of gene-disease association. (HuGE Navigator)
18977241 Observational study of gene-disease association. (HuGE Navigator)
17727244 Results describe PTEN and NDUFB8 aberrations in cervical cancer tissue.
17601350 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAVARAGVLGVQWLQRASRNVMPLGARTASHMTKDMFPGPYPRTPEERAAAAKKYNMRVEDYEPYPDDGM      1 - 70
GYGDYPKLPDRSQHERDPWYSWDQPGLRLNWGEPMHWHLDMYNRNRVDTSPTPVSWHVMCMQLFGFLAFM     71 - 140
IFMCWVGDVYPVYQPVGPKQYPYNNLYLERGGDPSKEPERVVHYEI                            141 - 186
//

Text Mined References (22)

PMID Year Title
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
21269460 2011 Initial characterization of the human central proteome.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
18977241 2008 Oxidative stress, telomere length and biomarkers of physical aging in a cohort aged 79 years from the 1932 Scottish Mental Survey.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17727244 2007 PTEN and NDUFB8 aberrations in cervical cancer tissue.
17601350 2007 A genetic association analysis of cognitive ability and cognitive ageing using 325 markers for 109 genes associated with oxidative stress or cognition.
16806233 2007 Identifying leukocyte gene expression patterns associated with plasma lipid levels in human subjects.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11256614 2000 Systematic subcellular localization of novel proteins identified by large-scale cDNA sequencing.
11230166 2001 Toward a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs.
11042152 2000 Cloning and functional analysis of cDNAs with open reading frames for 300 previously undefined genes expressed in CD34+ hematopoietic stem/progenitor cells.
10570959 1999 Identification of 167 polymorphisms in 88 genes from candidate neurodegeneration pathways.
9878551 1998 cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.
9763676 1998 Mapping of the NDUFA2, NDUFA6, NDUFA7, NDUFB8, and NDUFS8 electron transport chain genes by intron based radiation hybrid mapping.
9345899 1997 In situ hybridisation mapping of genomic clones for five human respiratory chain complex I genes.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.