Property Summary

NCBI Gene PubMed Count 27
PubMed Score 6.80
PubTator Score 133.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
acute myeloid leukemia -1.100 4.3e-03
Multiple myeloma 1.158 1.7e-03
osteosarcoma 1.515 9.9e-04
pancreatic ductal adenocarcinoma liver m... -1.340 3.7e-03
psoriasis 1.900 4.3e-05

Protein-protein Interaction (3)

Gene RIF (8)

AA Sequence

MTGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQKMGPMEKFWNKFLENKSPWRKMVHGVYKKSIF      1 - 70
VFTHVLVPVWIIHYYMKYHVSEKPYGIVEKKSRIFPGDTILETGEVIPPMKEFPDQHH                 71 - 128
//

Text Mined References (30)

PMID Year Title