Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 27.79
PubTator Score 3.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
astrocytic glioma -1.100 2.7e-02
Multiple myeloma 1.511 3.9e-04
ovarian cancer -1.600 1.1e-05
Waldenstrons macroglobulinemia 1.291 1.9e-03

Gene RIF (6)

AA Sequence

MAAMSLLRRVSVTAVAALSGRPLGTRLGFGGFLTRGFPKAAAPVRHSGDHGKRLFVIRPSRFYDRRFLKL      1 - 70
LRFYIALTGIPVAIFITLVNVFIGQAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVL     71 - 140
QIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN                         141 - 189
//

Text Mined References (20)

PMID Year Title