Property Summary

NCBI Gene PubMed Count 11
PubMed Score 128.23
PubTator Score 141.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.700 1.2e-03
lung cancer 1.200 1.2e-02
Multiple myeloma 1.530 1.7e-03
non primary Sjogren syndrome sicca 1.300 4.6e-02
osteosarcoma -1.760 1.1e-07
ovarian cancer 1.300 1.7e-03
tuberculosis and treatment for 6 months 1.200 3.6e-04

 GWAS Trait (1)

Gene RIF (1)

AA Sequence

MSFPKYKPSSLRTLPETLDPAEYNISPETRRAQAERLAIRAQLKREYLLQYNDPNRRGLIENPALLRWAY      1 - 70
ARTINVYPNFRPTPKNSLMGALCGFGPLIFIYYIIKTERDRKEKLIQEGKLDRTFHLSY                71 - 129
//

Text Mined References (16)

PMID Year Title