Property Summary

NCBI Gene PubMed Count 12
PubMed Score 4.76
PubTator Score 2.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma 1.200 3.2e-02
lung cancer -3.300 4.4e-02
malignant mesothelioma -1.100 2.9e-06
Multiple myeloma 1.519 2.1e-03
oligodendroglioma 1.100 3.6e-02
osteosarcoma 1.485 5.7e-06
Rheumatoid arthritis 1.200 2.5e-02

Gene RIF (1)

AA Sequence

MVNLLQIVRDHWVHVLVPMGFVIGCYLDRKSDERLTAFRNKSMLFKRELQPSEEVTWK                  1 - 58
//

Text Mined References (16)

PMID Year Title