Property Summary

NCBI Gene PubMed Count 8
PubMed Score 1.70
PubTator Score 36.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
psoriasis -1.200 1.7e-04
osteosarcoma -1.865 3.6e-07
tuberculosis and treatment for 6 months -1.100 1.3e-03
aldosterone-producing adenoma -1.096 1.8e-02

 MGI Phenotype (1)

Protein-protein Interaction (6)

Gene RIF (4)

PMID Text
24838397 NDUFAF7 functions to methylate NDUFS2 after it assembles into a complex I, stabilizing an early intermediate in the assembly pathway, and that this function is essential for normal vertebrate development.
24089531 NDUFAF7 methylates arginine 85 in the NDUFS2 subunit of human complex I.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20406883 a role for MidA in complex I assembly or stability

AA Sequence

MSVLLRSGLGPLCAVARAAIPFIWRGKYFSSGNEPAENPVTPMLRHLMYKIKSTGPITVAEYMKEVLTNP      1 - 70
AKGYYVYRDMLGEKGDFITSPEISQIFGELLGIWFISEWMATGKSTAFQLVELGPGRGTLVGDILRVFTQ     71 - 140
LGSVLKNCDISVHLVEVSQKLSEIQALTLTKEKVPLERNAGSPVYMKGVTKSGIPISWYRDLHDVPKGYS    141 - 210
FYLAHEFFDVLPVHKFQKTPQGWREVFVDIDPQVSDKLRFVLAPSATPAEAFIQHDETRDHVEVCPDAGV    211 - 280
IIEELSQRIALTGGAALVADYGHDGTKTDTFRGFCDHKLHDVLIAPGTADLTADVDFSYLRRMAQGKVAS    281 - 350
LGPIKQHTFLKNMGIDVRLKVLLDKSNEPSVRQQLLQGYDMLMNPKKMGERFNFFALLPHQRLQGGRYQR    351 - 420
NARQSKPFASVVAGFSELAWQ                                                     421 - 441
//

Text Mined References (14)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24838397 2014 The arginine methyltransferase NDUFAF7 is essential for complex I assembly and early vertebrate embryogenesis.
24292274 2014 A genome-wide association study identifies multiple susceptibility loci for chronic lymphocytic leukemia.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24089531 2013 NDUFAF7 methylates arginine 85 in the NDUFS2 subunit of human complex I.
22857522 2012 A three-dimensional topology of complex I inferred from evolutionary correlations.
22664934 2012 Comparison of tear protein levels in breast cancer patients and healthy controls using a de novo proteomic approach.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20406883 2010 MidA is a putative methyltransferase that is required for mitochondrial complex I function.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.