Property Summary

Ligand Count 1
NCBI Gene PubMed Count 16
PubMed Score 15.87
PubTator Score 13.64

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (3)

Gene RIF (11)

AA Sequence

MGWSQDLFRALWRSLSREVKEHVGTDQFGNKYYYIPQYKNWRGQTIREKRIVEAANKKEVDYEAGDIPTE      1 - 70
WEAWIRRTRKTPPTMEEILKNEKHREEIKIKSQDFYEKEKLLSKETSEELLPPPVQTQIKGHASAPYFGK     71 - 140
EEPSVAPSSTGKTFQPGSWMPRDGKSHNQ                                             141 - 169
//

Text Mined References (20)

PMID Year Title