Property Summary

Ligand Count 1
NCBI Gene PubMed Count 20
PubMed Score 10.26
PubTator Score 3.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute myeloid leukemia -1.200 2.4e-02
adult high grade glioma -1.100 2.1e-04
astrocytic glioma -1.500 1.4e-02
lung cancer 1.100 6.0e-04
medulloblastoma, large-cell -1.200 5.2e-05
Multiple myeloma 1.674 1.4e-04
ovarian cancer 2.100 6.0e-05
Waldenstrons macroglobulinemia 1.131 3.4e-03

 GWAS Trait (1)

Gene RIF (7)

AA Sequence

MPGIVELPTLEELKVDEVKISSAVLKAAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGKLVNKCALDF      1 - 70
FRQIKRHCAEPFTEYWTCIDYTGQQLFRHCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPEN     71 - 140
PYHSRPRPDPSPEIEGDLQPATHGSRFYFWTK                                          141 - 172
//

Text Mined References (26)

PMID Year Title