Property Summary

NCBI Gene PubMed Count 24
PubMed Score 32.84
PubTator Score 209.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Multiple myeloma 1.988 9.4e-05
osteosarcoma 1.193 1.0e-02
astrocytoma -1.300 2.4e-02
glioblastoma -1.300 2.5e-02
atypical teratoid / rhabdoid tumor -1.500 3.2e-05
hereditary spastic paraplegia -1.105 1.2e-02
Parkinson's disease -1.300 3.1e-02
lung carcinoma 1.400 2.7e-18

Gene RIF (7)

PMID Text
24717771 NDUFA3, NDUFA5 and NDUFA12 supernumerary subunits are necessary for complex I activity and biogenesis.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20825370 SNPs rs12666974 and rs3779262 significantly associated with autism
20825370 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19343046 Observational study of gene-disease association. (HuGE Navigator)
19064571 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLED      1 - 70
QLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI                             71 - 116
//

Text Mined References (29)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24717771 2014 Supernumerary subunits NDUFA3, NDUFA5 and NDUFA12 are required for the formation of the extramembrane arm of human mitochondrial complex I.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23088660 2013 Downregulation of the expression of mitochondrial electron transport complex genes in autism brains.
23051583 2012 Spatial distribution of cellular function: the partitioning of proteins between mitochondria and the nucleus in MCF7 breast cancer cells.
21775499 2011 Decreased expression of genes involved in oxidative phosphorylation in human pancreatic islets from patients with type 2 diabetes.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20825370 2011 The NADH-ubiquinone oxidoreductase 1 alpha subcomplex 5 (NDUFA5) gene variants are associated with autism.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20376309 2010 Gene expression patterns of oxidative phosphorylation complex I subunits are organized in clusters.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
19064571 2008 Polymorphisms in mitochondrial genes and prostate cancer risk.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16329995 2006 Identification of NADH dehydrogenase 1 alpha subcomplex 5 capable to transform murine fibroblasts and overexpressed in human cervical carcinoma cell lines.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10343126 1999 Genomic organization of the human complex I 13-kDa subunit gene NDUFA5.
10330338 1999 Human mitochondrial complex I in health and disease.
9878551 1998 cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.
9847074 1998 Toward a complete human genome sequence.
9763677 1998 Intron based radiation hybrid mapping of 15 complex I genes of the human electron transport chain.
9048877 1997 A human cDNA encoding the homologue of NADH: ubiquinone oxidoreductase subunit B13.
9021153 1997 Cloning of the human NADH: ubiquinone oxidoreductase subunit B13: localization to chromosome 7q32 and identification of a pseudogene on 11p15.