Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.12
PubTator Score 10.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.354 4.7e-03
Multiple myeloma 2.038 1.0e-05
astrocytoma -1.500 2.8e-03
pancreatic ductal adenocarcinoma liver m... -1.112 4.7e-02
ovarian cancer -1.300 1.6e-06

Gene RIF (2)

PMID Text
23746447 Findings support reassignment of the NDUFA4 protein to complex IV and suggest that patients with unexplained COX deficiency should be screened for NDUFA4 mutations.
20877624 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVD      1 - 70
YSKLKKERPDF                                                                71 - 81
//

Text Mined References (18)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25130324 2014 A genome-wide search for quantitative trait loci affecting the cortical surface area and thickness of Heschl's gyrus.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23746447 2013 NDUFA4 mutations underlie dysfunction of a cytochrome c oxidase subunit linked to human neurological disease.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23209302 2012 KIF14 negatively regulates Rap1a-Radil signaling during breast cancer progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22902835 2012 NDUFA4 is a subunit of complex IV of the mammalian electron transport chain.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
19822128 2009 DJ-1 binds to mitochondrial complex I and maintains its activity.
16729965 2006 Novel localization of OCTN1, an organic cation/carnitine transporter, to mammalian mitochondria.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12690205 2003 Human chromosome 7: DNA sequence and biology.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9878551 1998 cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.
9352085 1997 Cloning of the human cDNA sequence encoding the NADH:ubiquinone oxidoreductase MLRQ subunit.