Property Summary

Ligand Count 3
NCBI Gene PubMed Count 15
PubMed Score 14.32
PubTator Score 10.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytoma -1.500 2.8e-03
Multiple myeloma 2.038 1.0e-05
ovarian cancer -1.300 1.6e-06
pancreatic ductal adenocarcinoma liver m... -1.112 4.7e-02
Waldenstrons macroglobulinemia 1.354 4.7e-03

 GWAS Trait (1)

Gene RIF (2)

AA Sequence

MLRQIIGQAKKHPSLIPLFVFIGTGATGATLYLLRLALFNPDVCWDRNNPEPWNKLGPNDQYKFYSVNVD      1 - 70
YSKLKKERPDF                                                                71 - 81
//

Text Mined References (18)

PMID Year Title