Property Summary

NCBI Gene PubMed Count 68
PubMed Score 74.08
PubTator Score 75.45

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.292 5.4e-03
Multiple myeloma 2.280 3.1e-05
lung cancer 1.100 2.7e-03
Polycystic Ovary Syndrome 1.241 5.5e-03
ovarian cancer 3.100 1.7e-07

Gene RIF (47)

PMID Text
26769301 Aberrant endometrial expression of GRIM-19 was associated with adenomyosis through the regulation of apoptosis and angiogenesis.
26458553 Transfection with eukaryotic plasmid for the simultaneous expression of GRIM19 and LKB1 more effectively suppressed the growth of breast cancer in vitro and in vivo, and may therefore have therapeutic potential for the treatment of human breast cancer.
26363526 GRIM-19 expression is closely associated with colorectal cancer progression and might be a very promising prognostic biomarker
26188382 Data suggest that tumor expression of Ki67 (antigen Ki-67) and GRIM19 correlate with malignancy in thyroid Hurthle cell (HC) tumors; variable expression of Ki67 and GRIM19 may helped differentiate HC carcinoma from HC adenoma.
26011333 High expression of GW112 in colorectal cancer tissues and reduced expression of GRIM-19 in colorectal cancer tissues may be associated with abnormal proliferation of cancer cells.
25955394 Upregulation of GRIM-19 also suppressed the secretion of urokinase-type plasminogen activator (u-PA), matrix metalloproteinase (MMP)-2, MMP-9 and vascular endothelial growth factor (VEGF).
25901006 We established here a correlation between the first mutation identified in the NDUFA13 gene, which induces Mitochondrial complex I instability and a severe but slowly evolving clinical presentation affecting the central nervous system.
25575809 decreased GRIM-19 expression due to promoter hypermethylation may be important in head and neck carcinogenesis by promoting cell proliferation and regulating metabolic activity
25455534 The GRIM-19 deficiency in the villus may be associated with missed abortion via increasing apoptosis and affecting angiogenesis.
25242535 Simultaneous expression of ADAM10-specific siRNA and GRIM19 in HepG2 cancer cells significantly inhibited the proliferation, migration and invasion.
25174621 Upregulation of GRIM-19 in oral squamous cell carcinoma cells significantly inhibited cell proliferation, migration and invasion in vitro and suppressed tumor growth in vivo.
24690422 GRIM-19 may regulate the differentiation of normal cervical tissue, and a decrease in GRIM-19 may be the result of HR-HPV infection, which in turn leads to the malignant transformation of the cells.
24133585 silencing of survivin and over-expression of GRIM-19 can significantly inhibit the growth and induce the apoptosis of Hep-2 laryngeal cancer cells in vitro and in vivo.
23851499 GRIM-19 mutations are associated with oral squamous cell carcinoma.
23630608 Expressions of GRIM-19, NDUFS3, and extracellular matrix elements are correlated with invasive capabilities of breast cancer cell lines.
23618357 Down-regulation of GRIM-19 is associated with STAT3 overexpression in breast carcinomas.
23580587 Downregulation of GRIM-19 promotes HIF1alpha synthesis.
23529854 role in macrophage apoptosis induced by H5N1 virus
23386605 Tumor-derived mutations in the gene associated with retinoid interferon-induced mortality (GRIM-19) disrupt its anti-signal transducer and activator of transcription 3 (STAT3) activity and promote oncogenesis
23271731 import of the transcription factor STAT3 into mitochondria depends on GRIM-19, a component of the electron transport chain
23124042 GRIM-19 inhibits the STAT3 signaling pathway and sensitizes gastric cancer cells to radiation.
22573109 Our study found that GRIM-19 expression in lung cancer exhibits a relationship with the histological type and clinical stage
22492280 GRIM-19 expression is closely correlated with histological grading and p-STAT3 in hepatocellular carcinoma
22105514 GRIM-19 plays a critical role not only at the origin but also in the invasive progression of hepatocellular carcinoma.
21827581 GRIM-19 expression was lower in gliomas & negatively correlated with malignancy. Downregulation enhanced cell proliferation & migration, but overexpression did the opposite. GRIM-19 exerts its role through the non-STAT3 signaling pathway.
21765936 These data suggest that GRIM-19 can block E6/E6AP complex; and synergistically suppress cervical tumor growth with p53.
21664299 GRIM-19 function in cancer development
21351527 The expressions of survivin and GRIM-19 may be closely correlated with the pathogenesis of prostate cancer.
21040996 reduced mRNA and protein levels in lung adenocarcinoma tissues
20877624 Observational study of gene-disease association. (HuGE Navigator)
20595633 Results identify a major role for the N terminus of GRIM-19 in mediating its tumor-suppressive actions.
20522552 GRIM-19/CDKN2A synergistically suppressed cell cycle progression via inhibiting E2F1-driven gene expression.
20505682 Alternatively spliced GRIM-19 mRNA is associated with kidney cancer.
20478305 Loss of GRIM-19 is associated with invasion and metastasis of human gastric cancer.
19642906 Data show that restoration of GRIM-19 levels reestablishes the control over STAT3-dependent gene expression and tumor growth in vivo.
19622307 GRIM-19 expression is down-regulated in non-small cell lung cancer.
18287540 GRIM-19 is required for electron transfer activity of complex I, and disruption of mitochondrial transmembrane potential by GRIM-19 mutants enhances the cells' sensitivity to apoptotic stimuli.
18278448 GRIM19 in colon cancer cell lines could promote apoptotic cell death
18022871 GRIM-19 genetic alternations do not seem play a major role in predisposition to CD
17928352 results indicate that the high affinity between U95 early viral protein and GRIM-19 may be closely linked to the detrimental effect of HHV-6B infection on mitochondria.
17823279 GRIM-19 not only blocks src-induced gene expression through STAT3 but also the activation of cell adhesion molecules.
17626740 The low expression or absence of GRIM-19 may play an important role in the tumorigenesis of colorectal carcinoma.
17616678 GRIM-19 suppresses constitutive STAT3-induced cellular transformation in vitro and in vivo by down-regulating the expression of a number of cellular genes involved in cell proliferation and apoptosis
17523870 The IFN-beta- and tretinoin-induced GRIM-19 is upregulated during focal cerebral ischemia.
15753091 GRIM-19 may be a key component in NOD2-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes
12867595 GRIM-19 is an inhibitor of signal transducer and activator of transcription 3
12163600 results collectively indicate that viral interferon regulatory factor 1 modulates interferon/retinoic acid-cell death signals via interactions with GRIM19

AA Sequence

MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIA      1 - 70
LLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGF     71 - 140
MWYT                                                                      141 - 144
//

Text Mined References (74)

PMID Year Title
26769301 2016 Expression of GRIM-19 in adenomyosis and its possible role in pathogenesis.
26458553 2015 Additive effects of eukaryotic co?expression plasmid carrying GRIM?19 and LKB1 genes on breast cancer in vitro and in vivo.
26363526 2015 GRIM-19 expression is a potent prognostic marker in colorectal cancer.
26188382 2016 Thyroid Hürthle cell tumors: research of potential markers of malignancy.
26011333 Expression of GW112 and GRIM-19 in colorectal cancer tissues.
25955394 2015 Upregulation of GRIM-19 inhibits the growth and invasion of human breast cancer cells.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25901006 2015 Mutation in NDUFA13/GRIM19 leads to early onset hypotonia, dyskinesia and sensorial deficiencies, and mitochondrial complex I instability.
25575809 2015 Decreased expression of GRIM-19 by DNA hypermethylation promotes aerobic glycolysis and cell proliferation in head and neck squamous cell carcinoma.
25455534 2015 Expression of GRIM-19 in missed abortion and possible pathogenesis.
25242535 2014 Synergistic effects of co-expression plasmid?based ADAM10-specific siRNA and GRIM-19 on hepatocellular carcinoma in vitro and in vivo.
25174621 2014 Upregulation of GRIM-19 suppresses the growth of oral squamous cell carcinoma in vitro and in vivo.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24690422 2014 Decreased expression of GRIM-19 and its association with high-risk HPV infection in cervical squamous intraepithelial neoplasias and cancer.
24133585 2013 Small interfering RNA survivin and GRIM-19 co-expression salmonella plasmid inhibited the growth of laryngeal cancer cells in vitro and in vivo.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
23851499 2014 GRIM-19 mutations fail to inhibit v-Src-induced oncogenesis.
23630608 2013 Suppression of mitochondrial complex I influences cell metastatic properties.
23618357 2013 Down-regulation of GRIM-19 is associated with STAT3 overexpression in breast carcinomas.
23580587 2013 GRIM-19 opposes reprogramming of glioblastoma cell metabolism via HIF1? destabilization.
23529854 2013 Involvement of GRIM-19 in apoptosis induced in H5N1 virus-infected human macrophages.
23386605 2013 Tumor-derived mutations in the gene associated with retinoid interferon-induced mortality (GRIM-19) disrupt its anti-signal transducer and activator of transcription 3 (STAT3) activity and promote oncogenesis.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23271731 2013 The import of the transcription factor STAT3 into mitochondria depends on GRIM-19, a component of the electron transport chain.
23124042 2013 GRIM-19 inhibits the STAT3 signaling pathway and sensitizes gastric cancer cells to radiation.
22573109 2012 Expression and clinical significance of GRIM-19 in lung cancer.
22492280 2012 Downregulation of GRIM-19 is associated with hyperactivation of p-STAT3 in hepatocellular carcinoma.
22105514 2012 Depletion of GRIM-19 accelerates hepatocellular carcinoma invasion via inducing EMT and loss of contact inhibition.
21827581 2011 Downregulation of GRIM-19 promotes growth and migration of human glioma cells.
21765936 2011 GRIM-19 disrupts E6/E6AP complex to rescue p53 and induce apoptosis in cervical cancers.
21664299 2011 GRIM-19 function in cancer development.
21351527 2011 [Expressions of survivin and GRIM-19 in prostate cancer].
21269460 2011 Initial characterization of the human central proteome.
21040996 2011 Gene associated with retinoid-interferon-induced mortality-19 suppresses growth of lung adenocarcinoma tumor in vitro and in vivo.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20595633 2010 Identification of a structural motif in the tumor-suppressive protein GRIM-19 required for its antitumor activity.
20522552 2010 GRIM-19 and p16(INK4a) synergistically regulate cell cycle progression and E2F1-responsive gene expression.
20505682 2010 Identification of alternatively spliced GRIM-19 mRNA in kidney cancer tissues.
20478305 2010 Upregulation of the GRIM-19 gene suppresses invasion and metastasis of human gastric cancer SGC-7901 cell line.
19642906 2009 Down-regulation of GRIM-19 expression is associated with hyperactivation of STAT3-induced gene expression and tumor growth in human cervical cancers.
19622307 2009 [Expression and clinical significance of GRIM-19 in non-small cell lung cancer].
18287540 2008 GRIM-19 is essential for maintenance of mitochondrial membrane potential.
18278448 2008 Construction of recombinant adenovirus carrying GRIM19 and its effect on SW480 cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18022871 2008 GRIM-19 mutations are not associated with Crohn's disease.
17928352 2008 The U95 protein of human herpesvirus 6B interacts with human GRIM-19: silencing of U95 expression reduces viral load and abrogates loss of mitochondrial membrane potential.
17823279 2007 Tumor suppressive protein gene associated with retinoid-interferon-induced mortality (GRIM)-19 inhibits src-induced oncogenic transformation at multiple levels.
17626740 2007 [Correlations of GRIM-19 and its target gene product STAT3 to malignancy of human colorectal carcinoma].
17616678 2007 Tumor-suppressive activity of the cell death activator GRIM-19 on a constitutively active signal transducer and activator of transcription 3.
17523870 2007 The IFN-beta and retinoic acid-induced cell death regulator GRIM-19 is upregulated during focal cerebral ischemia.
17297443 2007 GRIM-19 associates with the serine protease HtrA2 for promoting cell death.
17209039 2007 Identification of mitochondrial complex I assembly intermediates by tracing tagged NDUFS3 demonstrates the entry point of mitochondrial subunits.
16826196 2007 Coupling mitochondrial respiratory chain to cell death: an essential role of mitochondrial complex I in the interferon-beta and retinoic acid-induced cancer cell death.
16341674 2005 Transcriptome analysis of human gastric cancer.
15841082 2005 Somatic and germline mutation in GRIM-19, a dual function gene involved in mitochondrial metabolism and cell death, is linked to mitochondrion-rich (Hurthle cell) tumours of the thyroid.
15753091 2005 GRIM-19 interacts with nucleotide oligomerization domain 2 and serves as downstream effector of anti-bacterial function in intestinal epithelial cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15367666 2004 GRIM-19, a cell death regulatory protein, is essential for assembly and function of mitochondrial complex I.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15231747 2004 A protein interaction framework for human mRNA degradation.
15059901 2004 GW112, a novel antiapoptotic protein that promotes tumor growth.
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12867595 2003 The cell death regulator GRIM-19 is an inhibitor of signal transducer and activator of transcription 3.
12837546 2003 The nuclear encoded subunits of complex I from bovine heart mitochondria.
12628925 2003 GRIM-19, a death-regulatory gene product, suppresses Stat3 activity via functional interaction.
12611891 2003 The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12163600 2002 Viral interferon regulatory factor 1 of Kaposi's sarcoma-associated herpesvirus interacts with a cell death regulator, GRIM19, and inhibits interferon/retinoic acid-induced cell death.
11522775 2001 GRIM-19, a cell death regulatory gene product, is a subunit of bovine mitochondrial NADH:ubiquinone oxidoreductase (complex I).
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.
10926209 2000 Chromosomal localization of human GRIM-19, a novel IFN-beta and retinoic acid-activated regulator of cell death.
10924506 2000 Identification of GRIM-19, a novel cell death-regulatory gene induced by the interferon-beta and retinoic acid combination, using a genetic approach.
10810093 2000 Identification of novel human genes evolutionarily conserved in Caenorhabditis elegans by comparative proteomics.